Pith. sign in

REVIEW 1 major objections 1 minor 54 references

Adaptive multi-line fitting for stable line-core intensity and Doppler velocity

T0 review · 1 major / 1 minor · reviewed 2026-05-21 · grok-4.3

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read LineFit uses adaptive Voigt fitting to stabilize core intensities and Doppler velocities from complex solar spectral profiles.

desk verdict LineFit gives a practical edge on split-core solar spectra in synthetic tests, but the robustness claim depends on how closely those tests match real observations. read the letter →

arxiv 2605.20861 v1 pith:K7LXHLR4 submitted 2026-05-20 astro-ph.SR astro-ph.IM

Shahin Jafarzadeh , David B. Jess , Marco Stangalini , Peter H. Keys , Glen Chambers , Samuel D. T. Grant , Michele Berretti , Timothy J. Duckenfield This is my paper · ORCID
classification astro-ph.SRastro-ph.IM
keywords solarspectroscopylineprofilefittingDopplervelocitymulti-linediagnosticsVoigtspectraltimeserieswaveanalysis
checked against Cost.FunctionalEquationalexander_duality_circle_linking
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper presents LineFit to solve the problem of tracking line cores reliably in dense spectral windows where profiles can split, blend, or turn asymmetric. Fast single-line estimators often produce intermittent misidentifications that create step artefacts and distort power spectra used for wave studies. LineFit applies bounded non-linear least-squares fits to Voigt-family profiles per line, adds asymmetric options, close-pair ownership rules, and split-core detection, then benchmarks the results against four standard methods on synthetic data with known truth. The method shows clearest gains precisely when profiles become intermittently split, delivering time series whose spectra match the ground truth more closely.

What carries the argument

LineFit, the adaptive multi-line fitting routine that performs bounded non-linear least-squares optimization of Voigt-family profiles with explicit split-core and blending controls.

What would settle it

Apply LineFit and the four baseline estimators to real solar spectrograph time series containing independently verified wave signals; if the power spectra or coherence measures from LineFit do not remain closer to the expected physical behaviour than the baselines, the robustness advantage would not hold.

Watch

Extended reading notes

Core claim

LineFit models each line locally with bounded non-linear least-squares fits to a Voigt-family profile, including an asymmetric-Voigt option to accommodate unequal wing broadening, and incorporates close-pair ownership control together with conservative, per-line window adaptation and split-core-aware handling. Using a synthetic time series with unambiguous ground truth, benchmarks show LineFit is most robust in key stress cases involving intermittently split-core profiles and correspondingly yields power spectra that agree most closely with the truth.

Load-bearing premise

The synthetic time series used for benchmarking accurately captures the morphological complexity, noise properties, and evolution rates present in real observational data from next-generation solar spectrographs.

Editorial extensions

If this is right

  • LineFit reduces step-like artefacts in intensity and velocity time series extracted from rapidly evolving or split-core profiles.
  • Downstream power spectra, phase, and coherence diagnostics become less biased by mis-tracking events.
  • A hybrid emulation layer can accelerate the fitting process by at least three orders of magnitude while preserving the accuracy gains.
  • The same fitting controls apply directly to any dense-window spectrograph that samples tens to hundreds of lines per spatial pixel.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Cleaner velocity and intensity series could improve multi-height tracking of magnetohydrodynamic waves across the solar atmosphere.
  • The method could be tested on archival or upcoming data from instruments that already record wide spectral windows to quantify real-world gains beyond synthetics.
  • Similar adaptive fitting logic might transfer to other domains that face crowded or variable line profiles, such as stellar atmospheres or laboratory plasma spectroscopy.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Request a human review

A listed scientist reviews the paper for a fee and the review publishes here regardless of verdict. See the reviewers or get listed.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

1 major / 1 minor

Summary. The manuscript introduces LineFit, an adaptive multi-line fitting procedure for extracting stable line-core intensity and Doppler velocity time series from dense spectral windows. Each line is modeled locally via bounded non-linear least-squares to a Voigt-family profile (with an asymmetric-Voigt option), incorporating close-pair ownership control, conservative per-line window adaptation, and split-core handling. Performance is assessed on a single synthetic time series with ground truth against four fast baselines, with the claim that LineFit is most robust for intermittently split-core profiles and yields power spectra closest to truth; a proof-of-principle supervised-emulation accelerator is also shown.

Significance. If the synthetic benchmarks prove representative, LineFit would offer a practical, reproducible improvement for multi-height MHD diagnostics in next-generation solar spectrographs by reducing step-like artefacts that bias wave and coherence analyses. The use of unambiguous ground-truth synthetics and the hybrid acceleration demonstration are clear strengths that support reproducibility and computational feasibility.

major comments (1)
  1. [Benchmarking section] Benchmarking section: the central claim that LineFit outperforms baselines specifically on intermittently split-core profiles and produces power spectra closest to ground truth is demonstrated exclusively on one synthetic time series. No quantitative comparison (histograms of asymmetry parameters, power-law indices of temporal variability, or noise power spectra) is provided between the synthetic ensemble and real data from instruments such as DKIST/VISP. This is load-bearing for the practical-superiority interpretation because the performance gap only implies utility for next-generation observations if the synthetic morphological complexity, blending rates, and noise properties match those of actual dense-window data.
minor comments (1)
  1. [Abstract] Abstract: quantitative error metrics, exact fitting bounds, and window-adaptation thresholds are not reported, making it difficult for readers to gauge the magnitude of the reported robustness improvement.

Simulated Author's Rebuttal

1 responses · 0 unresolved

We thank the referee for their constructive feedback on our manuscript. We address the major comment regarding the benchmarking section below and have updated the manuscript to incorporate additional comparisons that strengthen the connection to real observational data.

read point-by-point responses

  1. Referee: Benchmarking section: the central claim that LineFit outperforms baselines specifically on intermittently split-core profiles and produces power spectra closest to ground truth is demonstrated exclusively on one synthetic time series. No quantitative comparison (histograms of asymmetry parameters, power-law indices of temporal variability, or noise power spectra) is provided between the synthetic ensemble and real data from instruments such as DKIST/VISP. This is load-bearing for the practical-superiority interpretation because the performance gap only implies utility for next-generation observations if the synthetic morphological complexity, blending rates, and noise properties match those of actual dense-window data.

    Authors: We acknowledge that a direct quantitative comparison between the synthetic data and real observations would further bolster the interpretation of our results for practical applications. In the revised version of the manuscript, we have added a discussion in the Benchmarking section that compares key statistical properties of our synthetic time series to those reported in the literature for solar spectra observed with instruments like DKIST/VISP. This includes comparisons of asymmetry parameter distributions, temporal variability power-law indices, and noise power spectra. These additions demonstrate that the synthetic ensemble was designed to capture the relevant complexities of dense-window solar spectroscopy, thereby supporting the applicability of LineFit's superior performance in intermittently split-core cases to real data. We maintain that the use of ground-truth synthetics remains a key strength for rigorous evaluation, but agree that bridging to real data properties enhances the manuscript. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity; method and validation are independent of self-defined inputs

full rationale

The paper presents LineFit as a new adaptive multi-line fitting procedure using bounded non-linear least-squares to Voigt-family profiles with explicit options for asymmetry, close-pair control, and split-core handling. Performance is assessed via direct comparison to external synthetic ground truth and four independent fast baselines, with no equations or claims reducing fitted parameters back to quantities defined by LineFit itself. No load-bearing self-citations, uniqueness theorems, or ansatzes imported from prior author work are invoked to justify the core method. The derivation chain remains self-contained against the provided synthetic benchmark.

Assumptions & free parameters 1 free parameters · 1 assumptions · 0 invented entities

The method rests on standard non-linear least-squares assumptions and the appropriateness of Voigt-family profiles for solar lines; no new physical entities are postulated.

free parameters (1)
  • per-line fitting bounds and window adaptation thresholds
    These control parameters are chosen to accommodate profile evolution and are part of the adaptive procedure.
assumptions (1)
  • domain assumption Voigt-family profiles adequately model the observed solar spectral lines even when asymmetric or split.
    Invoked when choosing the functional form for the local fits.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Adaptive multi-line fitting for stable line-core intensity and Doppler velocity." pith.science (2026). https://pith.science/paper/K7LXHLR4

@misc{pith2026260520861,
  author       = {Pith},
  title        = {Pith review of: Adaptive multi-line fitting for stable line-core intensity and Doppler velocity},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/K7LXHLR4}},
  note         = {Machine review of arXiv:2605.20861}
}
read the original abstract

Next-generation solar spectrographs increasingly record dense wavelength windows in which tens to hundreds of spectral lines are sampled at each spatial location and time step. This expands the scope for multi-line, multi-height diagnostics of magnetohydrodynamic motions, but also raises a practical challenge: deriving stable line-core intensity and line-of-sight velocity time series when profiles evolve rapidly, become asymmetric, blend, or develop multi-lobed cores. Common fast estimators can perform well for simple, isolated absorption lines, yet can intermittently misidentify the core in crowded or morphologically complex cases. Even infrequent mis-tracking can leave step-like artefacts that redistribute power and bias spectral, phase, and coherence measures used in wave and dynamics analyses. We introduce LineFit, a fully reproducible adaptive multi-line fitting approach tailored to dense-window spectroscopy. LineFit models each line locally with bounded non-linear least-squares fits to a Voigt-family profile, including an asymmetric-Voigt option to accommodate unequal wing broadening, and incorporates close-pair ownership control together with conservative, per-line window adaptation and split-core-aware handling. Using a synthetic time series with unambiguous ground truth, we benchmark LineFit against four widely used fast baselines and assess both instantaneous centre errors and downstream time-series diagnostics. Several fast methods remain competitive for many lines, whereas LineFit is most robust in key stress cases involving intermittently split-core profiles and correspondingly yields power spectra that agree most closely with the truth. We also demonstrate a proof-of-principle that benchmarks hybrid acceleration of the LineFit software via supervised emulation, offering at least three orders-of-magnitude improvement in processing time.

Figures

Figures reproduced from arXiv: 2605.20861 by the authors.

Figure 1
Figure 1. Example synthetic spectrum and line-centre recovery. The blue curve shows the normalised spectrum; red dashed segments indicate the fitted model within each adaptive window. Vertical markers show the recovered centres (green dashed) and the truth centres (black dotted). Numbered circles label the ten diagnostic lines used throughout the testbed. A schematic summary of this workflow is provided in [PITH_FULL_IMAGE:f… view at source ↗
Figure 2
Figure 2. Schematic overview of the LineFit workflow. The method proceeds through three coupled stages: (i) coarse seeding, including local search near the expected wavelength together with offset guarding and close-pair ownership control; (ii) adaptive windowing, in which per-line windows are conservatively adjusted within prescribed bounds and morphology checks activate safer handling when needed; and (iii) iterative bounde… view at source ↗
Figure 3
Figure 3. Instantaneous centre accuracy comparison for a representative synthetic time step (t = 0 s). Lower panel: spectrum with recovered centres from LineFit and four fast baselines overplotted, alongside the truth centres. Upper panel: normalised absolute centre residuals (|∆λi |/ max |∆λi |) across methods for each line; text annotations show the corresponding absolute maximum |∆λi | per line (pm). 3.2 Time-series fideli… view at source ↗
Figures from the paper (2 more)
Figure 4
Figure 4. Figure 4: Velocity time-series fidelity over the full synthetic sequence. Rows (a–c): examples for an isolated symmetric line (line 1), an asymmetric/blended line (line 2), and a split-core/emission-reversal line (line 6). Each row shows truth and one recovered method per sub-pa…
Figure 5
Figure 5. Figure 5: Propagation of centre-extraction errors into wave diagnostics. Refined Global Wavelet Spectra (RGWS) computed from velocity time series recovered by each method, compared against the truth RGWS. (a) Example blended line (line 4): all methods recover the main peak struc…

Discussion (0). Continue with ORCID to comment.

Lean theorems connected to this paper

Citations machine-checked in the Pith Canon. Every link opens the source theorem in the public Lean library.

  • IndisputableMonolith/Cost/FunctionalEquation.lean washburn_uniqueness_aczel unclear
    ?
    unclear

    Relation between the paper passage and the cited Recognition theorem.

    LineFit models each line locally with bounded non-linear least-squares fits to a Voigt-family profile, including an asymmetric-Voigt option

  • IndisputableMonolith/Foundation/AlexanderDuality.lean alexander_duality_circle_linking unclear
    ?
    unclear

    Relation between the paper passage and the cited Recognition theorem.

    split-core-aware handling

What do these tags mean?
matches
The paper's claim is directly supported by a theorem in the formal canon.
supports
The theorem supports part of the paper's argument, but the paper may add assumptions or extra steps.
extends
The paper goes beyond the formal theorem; the theorem is a base layer rather than the whole result.
uses
The paper appears to rely on the theorem as machinery.
contradicts
The paper's claim conflicts with a theorem or certificate in the canon.
unclear
Pith found a possible connection, but the passage is too broad, indirect, or ambiguous to say the theorem truly supports the claim.

Reference graph

Works this paper leans on

54 extracted references · 54 canonical work pages

  1. [1]

    Astronomy & Astrophysics 626, A102

    Asensio Ramos , A. and D \' az Baso , C. J. (2019). Stokes inversion based on convolutional neural networks . 626, A102. doi:10.1051/0004-6361/201935628 2019A&A...626A.102A

    work page doi:10.1051/0004-6361/201935628 2019

  2. [2]

    B., Grant , S

    Bate , W., Jess , D. B., Grant , S. D. T., Hillier , A., Skirvin , S. J., Van Doorsselaere , T., et al. (2024). Unveiling the True Nature of Plasma Dynamics from the Reference Frame of a Superpenumbral Fibril . 970, 66. doi:10.3847/1538-4357/ad4d97 2024ApJ...970...66B

    work page doi:10.3847/1538-4357/ad4d97 2024

  3. [3]

    Beckers , J. M. and Brown , T. M. (2013). The History of the Fourier Tachometer . In Fifty Years of Seismology of the Sun and Stars, eds. K. Jain , S. C. Tripathy , F. Hill , J. W. Leibacher , and A. A. Pevtsov . vol. 478 of Astronomical Society of the Pacific Conference Series, 93 2013ASPC..478...93B

    work page 2013

  4. [4]

    , keywords =

    Berretti , M., Stangalini , M., Verth , G., Fedun , V., Jafarzadeh , S., Jess , D. B., et al. (2025). Umbral oscillations in the photosphere: A comprehensive statistical study . 697, A156. doi:10.1051/0004-6361/202453176 2025A&A...697A.156B

    work page doi:10.1051/0004-6361/202453176 2025

  5. [5]

    M., Tomczyk, S., Kubo, M., et al

    Borrero , J. M., Tomczyk , S., Kubo , M., Socas-Navarro , H., Schou , J., Couvidat , S., et al. (2011). VFISV: Very Fast Inversion of the Stokes Vector for the Helioseismic and Magnetic Imager . 273, 267--293. doi:10.1007/s11207-010-9515-6 2011SoPh..273..267B

    work page doi:10.1007/s11207-010-9515-6 2011

  6. [6]

    Bouchy , F., Pepe , F., and Queloz , D. (2001). Fundamental photon noise limit to radial velocity measurements . 374, 733--739. doi:10.1051/0004-6361:20010730 2001A&A...374..733B

    work page doi:10.1051/0004-6361:20010730 2001

  7. [7]

    Calchetti , D., Stangalini , M., Jafarzadeh , S., Valori , G., Albert , K., Albelo Jorge , N., et al. (2023). Spectropolarimetric investigation of magnetohydrodynamic wave modes in the photosphere: First results from PHI on board Solar Orbiter . 674, A109. doi:10.1051/0004-6361/202245826 2023A&A...674A.109C

    work page doi:10.1051/0004-6361/202245826 2023

  8. [8]

    H., & Orozco Su´ arez, D

    Campbell , R. J., Mathioudakis , M., Quintero Noda , C., Keys , P. H., and Orozco Su \'a rez , D. (2025). Application of Deep Learning to the Classification of Stokes Profiles: From the Quiet Sun to Sunspots . 988, 9. doi:10.3847/1538-4357/addb49 2025ApJ...988....9C

    work page doi:10.3847/1538-4357/addb49 2025

Show all 54 references
  1. [9]

    B., Jafarzadeh, S., Berretti, M., Grant, S

    Chambers, G., Jess, D. B., Jafarzadeh, S., Berretti, M., Grant, S. D. T., Stangalini, M., et al. (2026). Standing oscillations in a resonant sunspot atmosphere captured by integral field spectroscopy. Frontiers in Astronomy and Space Sciences in prep. Submitted to Frontiers in...

    2026

  2. [10]

    P., Wachter , R., Sankarasubramanian , K., Schou , J., and Scherrer , P

    Couvidat , S., Rajaguru , S. P., Wachter , R., Sankarasubramanian , K., Schou , J., and Scherrer , P. H. (2012). Line-of-Sight Observables Algorithms for the Helioseismic and Magnetic Imager (HMI) Instrument Tested with Interferometric Bidimensional Spectrometer (IBIS) Observa...

    2012 doi

  3. [11]

    de la Cruz Rodr \' guez , J., Leenaarts , J., Danilovic , S., and Uitenbroek , H. (2019). STiC: A multiatom non-LTE PRD inversion code for full-Stokes solar observations . 623, A74. doi:10.1051/0004-6361/201834464 2019A&A...623A..74D

    2019 doi

  4. [12]

    and Nakariakov , V

    De Moortel , I. and Nakariakov , V. M. (2012). Magnetohydrodynamic waves and coronal seismology: an overview of recent results . Philosophical Transactions of the Royal Society of London Series A 370, 3193--3216. doi:10.1098/rsta.2011.0640 2012RSPTA.370.3193D

    2012 doi

  5. [13]

    R., Daw , A., Hansteen , V., et al

    De Pontieu , B., Mart \' nez-Sykora , J., Testa , P., Winebarger , A. R., Daw , A., Hansteen , V., et al. (2020). The Multi-slit Approach to Coronal Spectroscopy with the Multi-slit Solar Explorer (MUSE) . 888, 3. doi:10.3847/1538-4357/ab5b03 2020ApJ...888....3D

    2020 doi

  6. [14]

    M., Lemen , J

    De Pontieu , B., Title , A. M., Lemen , J. R., Kushner , G. D., Akin , D. J., Allard , B., et al. (2014). The Interface Region Imaging Spectrograph (IRIS) . 289, 2733--2779. doi:10.1007/s11207-014-0485-y 2014SoPh..289.2733D

    2014 doi

  7. [15]

    J., Jess , D

    Duckenfield , T. J., Jess , D. B., Morton , R. J., and Jafarzadeh , S. (2025). Determining the Polarization of a Coronal Standing Kink Oscillation Using Spectral Imaging Techniques with CoMP . 982, 202. doi:10.3847/1538-4357/adb8d6 2025ApJ...982..202D

    2025 doi

  8. [16]

    A., Korpi-Lagg , A., et al

    Feller , A., Gandorfer , A., Grauf , B., H \"o lken , J., Iglesias , F. A., Korpi-Lagg , A., et al. (2025). The Sunrise Ultraviolet Spectropolarimeter and Imager: Instrument Description . 300, 65. doi:10.1007/s11207-025-02471-7 2025SoPh..300...65F

    2025 doi

  9. [17]

    Figueira , P. (2018). Deriving High-Precision Radial Velocities . In Asteroseismology and Exoplanets: Listening to the Stars and Searching for New Worlds, eds. T. L. Campante , N. C. Santos , and M. J. P. F. G. Monteiro . vol. 49 of Astrophysics and Space Science Proceedings, ...

    2018 doi

  10. [18]

    C., Pepe , F., Lovis , C., and Nardetto , N

    Figueira , P., Santos , N. C., Pepe , F., Lovis , C., and Nardetto , N. (2013). Line-profile variations in radial-velocity measurements. Two alternative indicators for planetary searches . 557, A93. doi:10.1051/0004-6361/201220779 2013A&A...557A..93F

    2013 doi

  11. [19]

    K., Fligge , M., and Bruls , J

    Frutiger , C., Solanki , S. K., Fligge , M., and Bruls , J. H. M. J. (2000). Properties of the solar granulation obtained from the inversion of low spatial resolution spectra . 358, 1109--1121 2000A&A...358.1109F

    2000

  12. [20]

    A., Jess , D

    Gilchrist-Millar , C. A., Jess , D. B., Grant , S. D. T., Keys , P. H., Beck , C., Jafarzadeh , S., et al. (2021). Magnetoacoustic wave energy dissipation in the atmosphere of solar pores . Philosophical Transactions of the Royal Society of London Series A 379, 20200172. doi:1...

    2021 doi

  13. [21]

    Goodfellow, I., Bengio, Y., and Courville, A. (2016). Deep Learning (MIT Press). http://www.deeplearningbook.org Goodfellow2016

    2016

  14. [22]

    Grant, S. D. T., Berretti, M., Chambers, G., Jess, D. B., Stangalini, M., Jafarzadeh, S., et al. (2026). Probing oscillations in the lower solar atmosphere with the francis integral field unit. Frontiers in Astronomy and Space Sciences in prep. Submitted to Frontiers in Astron...

    2026

  15. [23]

    Grant , S. D. T., Jess , D. B., Stangalini , M., Jafarzadeh , S., Fedun , V., Verth , G., et al. (2022). The Propagation of Coherent Waves Across Multiple Solar Magnetic Pores . 938, 143. doi:10.3847/1538-4357/ac91ca 2022ApJ...938..143G

    2022 doi

  16. [24]

    K., Feller , A., Doerr , H.-P., Cao , W., et al

    H \"o lken , J., van Noort , M., Solanki , S. K., Feller , A., Doerr , H.-P., Cao , W., et al. (2026). Toward solar many-line inversions of high-resolution spectropolarimetric data . 705, A220. doi:10.1051/0004-6361/202556890 2026A&A...705A.220H

    2026 doi

  17. [25]

    Iglesias , F. A. and Feller , A. (2019). Instrumentation for solar spectropolarimetry: state of the art and prospects . Optical Engineering 58, 082417. doi:10.1117/1.OE.58.8.082417 2019OptEn..58h2417I

    2019 doi

  18. [26]

    B., Stangalini , M., Grant , S

    [Dataset] Jafarzadeh , S., Jess , D. B., Stangalini , M., Grant , S. D. T., Higham , J. E., Pessah , M. E., et al. (2025 a ). Walsatools - wave analysis tools. doi:10.5281/zenodo.17569951 walsatools..2025...17569951

    2025 doi

  19. [27]

    B., Stangalini , M., Grant , S

    Jafarzadeh , S., Jess , D. B., Stangalini , M., Grant , S. D. T., Higham , J. E., Pessah , M. E., et al. (2025 b ). Wave analysis tools . Nature Reviews Methods Primers 5, 21. doi:10.1038/s43586-025-00392-0 2025NRvMP...5...21J

    2025 doi

  20. [28]

    B., Stangalini , M., Keys , P

    Jafarzadeh , S., Jess , D. B., Stangalini , M., Keys , P. H., Grant , S. D. T., Duckenfield , T. J., et al. (2026 a ). Magnetically Structured Oscillatory Power Along an Active-Region Transect in Near-UV Sunrise iii /SUSI Spectroscopy . in prep. (Focus Issue on Early Science R...

    2026

  21. [29]

    B., Stangalini , M., Morton , R

    Jafarzadeh , S., Jess , D. B., Stangalini , M., Morton , R. J., Felipe , T., Berretti , M., et al. (2026 b ). Multi-line Wave Signatures in a Sunspot from Near-UV Sunrise iii /SUSI Observations . in prep. (Focus Issue on Early Science Results from Sunrise iii ) Jafarzadeh2026_paper1

    2026

  22. [30]

    E., Tremblay , B., Centeno , R., and Rempel , M

    Jarolim , R., Molnar , M. E., Tremblay , B., Centeno , R., and Rempel , M. (2025). PINN ME: A Physics-informed Neural Network Framework for Accurate Milne-Eddington Inversions of Solar Magnetic Fields. 985, L7. doi:10.48550/arXiv.2502.13924 2025ApJ...985L...7J

    2025 doi

  23. [31]

    B., Grant , S

    Jess , D. B., Grant , S. D. T., Bate , W., Liu , J., Jafarzadeh , S., Keys , P. H., et al. (2023 a ). The Fibre Resolved OpticAl and Near-Ultraviolet Czerny-Turner Imaging Spectropolarimeter (FRANCIS) . 298, 146. doi:10.1007/s11207-023-02237-z 2023SoPh..298..146J

    2023 doi

  24. [32]

    B., Jafarzadeh , S., Keys , P

    Jess , D. B., Jafarzadeh , S., Keys , P. H., Stangalini , M., Verth , G., and Grant , S. D. T. (2023 b ). Waves in the lower solar atmosphere: the dawn of next-generation solar telescopes . Living Reviews in Solar Physics 20, 1. doi:10.1007/s41116-022-00035-6 2023LRSP...20....1J

    2023 doi

  25. [33]

    B., Keys , P

    Jess , D. B., Keys , P. H., Stangalini , M., and Jafarzadeh , S. (2021). High-resolution wave dynamics in the lower solar atmosphere . Philosophical Transactions of the Royal Society of London Series A 379, 20200169. doi:10.1098/rsta.2020.0169 2021RSPTA.37900169J

    2021 doi

  26. [34]

    B., Morton , R

    Jess , D. B., Morton , R. J., Verth , G., Fedun , V., Grant , S. D. T., and Giagkiozis , I. (2015). Multiwavelength Studies of MHD Waves in the Solar Chromosphere. An Overview of Recent Results . 190, 103--161. doi:10.1007/s11214-015-0141-3 2015SSRv..190..103J

    2015 doi

  27. [35]

    C., Solanki , S

    Katsukawa , Y., del Toro Iniesta , J. C., Solanki , S. K., Kubo , M., Hara , H., Shimizu , T., et al. (2020). Sunrise Chromospheric Infrared SpectroPolarimeter (SCIP) for sunrise III: system design and capability . In Ground-based and Airborne Instrumentation for Astronomy VII...

    2020 doi

  28. [36]

    K., del Toro Iniesta , J

    Korpi-Lagg , A., Gandorfer , A., Solanki , S. K., del Toro Iniesta , J. C., Katsukawa , Y., Bernasconi , P., et al. (2025). SUNRISE III: Overview of Observatory and Instruments . 300, 75. doi:10.1007/s11207-025-02485-1 2025SoPh..300...75K

    2025 doi

  29. [37]

    N., Solanki , S

    Lagg , A., Smitha , H. N., Solanki , S. K., and et al. (2026). Direct Measurement of the Height Dependence of p -mode Propagation in the Lower Solar Atmosphere with Sunrise iii . in prep. (Focus Issue on Early Science Results from Sunrise iii ) Lagg+2026

    2026

  30. [38]

    Lagg , A., Woch , J., Krupp , N., and Solanki , S. K. (2004). Retrieval of the full magnetic vector with the He I multiplet at 1083 nm. Maps of an emerging flux region . 414, 1109--1120. doi:10.1051/0004-6361:20031643 2004A&A...414.1109L

    2004 doi

  31. [39]

    Lecun , Y., Bottou , L., Bengio , Y., and Haffner , P. (1998). Gradient-based learning applied to document recognition . IEEE Proceedings 86, 2278--2324. doi:10.1109/5.726791 1998IEEEP..86.2278L

    1998 doi

  32. [40]

    Lites , B., Casini , R., Garcia , J., and Socas-Navarro , H. (2007). A suite of community tools for spectro-polarimetric analysis . 78, 148 2007MmSAI..78..148L

    2007

  33. [41]

    D., Jess , D

    MacBride , C. D., Jess , D. B., Grant , S. D. T., Khomenko , E., Keys , P. H., and Stangalini , M. (2021). Accurately constraining velocity information from spectral imaging observations using machine learning techniques . Philosophical Transactions of the Royal Society of Lon...

    2021 doi

  34. [42]

    and van Noort , M

    Mili \'c , I. and van Noort , M. (2018). Spectropolarimetric NLTE inversion code SNAPI . 617, A24. doi:10.1051/0004-6361/201833382 2018A&A...617A..24M

    2018 doi

  35. [43]

    P., Bello Gonz \'a lez , N., Bellot Rubio , L., Cao , W., Cauzzi , G., Deluca , E., et al

    Rast , M. P., Bello Gonz \'a lez , N., Bellot Rubio , L., Cao , W., Cauzzi , G., Deluca , E., et al. (2021). Critical Science Plan for the Daniel K. Inouye Solar Telescope (DKIST) . 296, 70. doi:10.1007/s11207-021-01789-2 2021SoPh..296...70R

    2021 doi

  36. [44]

    Riethm \"u ller , T. L. and Solanki , S. K. (2019). The potential of many-line inversions of photospheric spectropolarimetric data in the visible and near UV . 622, A36. doi:10.1051/0004-6361/201833379 2019A&A...622A..36R

    2019 doi

  37. [45]

    and del Toro Iniesta , J

    Ruiz Cobo , B. and del Toro Iniesta , J. C. (1992). Inversion of Stokes Profiles . 398, 375. doi:10.1086/171862 1992ApJ...398..375R

    1992 doi

  38. [46]

    Ruiz Cobo , B., Quintero Noda , C., Gafeira , R., Uitenbroek , H., Orozco Su \'a rez , D., and P \'a ez Ma \ n \'a , E. (2022). DeSIRe: Departure coefficient aided Stokes Inversion based on Response functions . 660, A37. doi:10.1051/0004-6361/202140877 2022A&A...660A..37R

    2022 doi

  39. [47]

    Shimizu , T., Imada , S., Kawate , T., Suematsu , Y., Hara , H., Tsuzuki , T., et al. (2021). The Solar-C (EUVST) mission: the latest status . In Society of Photo-Optical Instrumentation Engineers (SPIE) Conference Series, eds. J.-W. A. den Herder , S. Nikzad , and K. Nakazawa...

    2021 doi

  40. [48]

    Socas-Navarro , H., de la Cruz Rodr \' guez , J., Asensio Ramos , A., Trujillo Bueno , J., and Ruiz Cobo , B. (2015). An open-source, massively parallel code for non-LTE synthesis and inversion of spectral lines and Zeeman-induced Stokes profiles . 577, A7. doi:10.1051/0004-63...

    2015 doi

  41. [49]

    K., Smitha , H

    Solanki , S. K., Smitha , H. N., Lagg , A., and et al. (2026). Sunrise iii : Instrument, mission, data, and first results . in prep. (Focus Issue on Early Science Results from Sunrise iii ) solankietal2026

    2026

  42. [50]

    B., Verth , G., Fedun , V., Fleck , B., Jafarzadeh , S., et al

    Stangalini , M., Jess , D. B., Verth , G., Fedun , V., Fleck , B., Jafarzadeh , S., et al. (2021). A novel approach to identify resonant MHD wave modes in solar pores and sunspot umbrae: B - analysis . 649, A169. doi:10.1051/0004-6361/202140429 2021A&A...649A.169S

    2021 doi

  43. [51]

    A., Jess , D

    Stangalini , M., Verth , G., Fedun , V., Aldhafeeri , A. A., Jess , D. B., Jafarzadeh , S., et al. (2022). Large scale coherent magnetohydrodynamic oscillations in a sunspot . Nature Communications 13, 479. doi:10.1038/s41467-022-28136-8 2022NatCo..13..479S

    2022 doi

  44. [52]

    R., Berukoff , S., Casini , R., Kuhn , J

    Tritschler , A., Rimmele , T. R., Berukoff , S., Casini , R., Kuhn , J. R., Lin , H., et al. (2016). Daniel K. Inouye Solar Telescope: High-resolution observing of the dynamic Sun . Astronomische Nachrichten 337, 1064. doi:10.1002/asna.201612434 2016AN....337.1064T

    2016 doi

  45. [53]

    Tziotziou , K., Tsiropoula , G., Mein , N., and Mein , P. (2007). Dual-line spectral and phase analysis of sunspot oscillations . 463, 1153--1163. doi:10.1051/0004-6361:20066412 2007A&A...463.1153T

    2007 doi

  46. [54]

    Uitenbroek , H. (2003). The Accuracy of the Center-of-Gravity Method for Measuring Velocity and Magnetic Field Strength in the Solar Photosphere . 592, 1225--1233. doi:10.1086/375736 2003ApJ...592.1225U

    2003 doi

Pith tools

Reviewed May 21, 2026 · model on record in the stance chip above.