pith. sign in

arxiv: 1604.01559 · v1 · pith:CMGEKHBHnew · submitted 2016-04-06 · ❄️ cond-mat.mes-hall

Strong spin-orbit fields and Dyakonov-Perel spin dephasing in supported metallic films

classification ❄️ cond-mat.mes-hall
keywords spindecaydephasingfilmsinitialdyakonov-perelexaminedfields
0
0 comments X
read the original abstract

Spin dephasing by the Dyakonov-Perel mechanism in metallic films deposited on insulating substrates is revealed, and quantitatively examined by means of density functional calculations combined with a kinetic equation. The surface-to-substrate asymmetry, probed by the metal wave functions in thin films, is found to produce strong spin-orbit fields and a fast Larmor precession, giving a dominant contribution to spin decay over the Elliott-Yafet spin relaxation up to a thickness of 70 nm. The spin dephasing is oscillatory in time with a rapid (sub-picosecond) initial decay. However, parts of the Fermi surface act as spin traps, causing a persistent tail signal lasting 1000 times longer than the initial decay time. It is also found that the decay depends on the direction of the initial spin polarization, resulting in a spin-dephasing anisotropy of 200% in the examined cases.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.