pith. sign in

arxiv: 1508.02464 · v2 · pith:JINQTFJHnew · submitted 2015-08-11 · 🧮 math.NT

The density of primes dividing a particular non-linear recurrence sequence

classification 🧮 math.NT
keywords sequencefracdensitydividingellipticequivgaloispmod
0
0 comments X
read the original abstract

Define the sequence $\{b_n\}$ by $b_0=1,b_1=1, b_2=2,b_3=1$, and $$b_n=\begin{cases} \frac{b_{n-1}b_{n-3}-b_{n-2}^2}{b_{n-4}}&\textrm{if}~ n\not\equiv 0\pmod 3, \frac{b_{n-1}b_{n-3}-3b_{n-2}^2}{b_{n-4}}&\textrm{if}~ n\equiv 0\pmod 3. We relate this sequence $\{b_n\}$ to the coordinates of points on the elliptic curve $E:y^2+y=x^3-3x+4$. We use Galois representations attached to $E$ to prove that the density of primes dividing a term in this sequence is equal to $\frac{179}{336}$. Furthermore, we describe an infinite family of elliptic curves whose Galois images match that of $E$.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.