pith. sign in

arxiv: 0710.1765 · v1 · submitted 2007-10-09 · ❄️ cond-mat.other

NMR Time Reversal as a Probe of Incipient Turbulent Spin Dynamics

classification ❄️ cond-mat.other
keywords spindynamicseffectivemagicmagnetizednuclearprecessionprobe
0
0 comments X
read the original abstract

We demonstrate time reversal of nuclear spin dynamics in highly magnetized dilute liquid 3He-4He mixtures through effective inversion of long-range dipolar interactions. These experiments, which involve using magic sandwich NMR pulse sequences to generate spin echoes, probe the spatiotemporal development of turbulent spin dynamics and promise to serve as a versatile tool for the study and control of dynamic magnetization instabilities. We also show that a repeated magic sandwich pulse sequence can be used to dynamically stabilize modes of nuclear precession that are otherwise intrinsically unstable. To date, we have extended the effective precession lifetimes of our magnetized samples by more than three orders of magnitude.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.