pith. sign in

arxiv: 0710.5195 · v1 · submitted 2007-10-26 · 🧬 q-bio.MN · q-bio.SC

MAPK Cascades as Feedback Amplifiers

classification 🧬 q-bio.MN q-bio.SC
keywords feedbackmapkcascadesamplifiercascadepathwaysactingamplifiers
0
0 comments X
read the original abstract

Interconvertible enzyme cascades, exemplified by the mitogen activated protein kinase (MAPK) cascade, are a frequent mechanism in signal transduction pathways. There has been much speculation as to the role of these pathways, and how their structure is related to their function. A common conclusion is that the cascades serve to amplify biochemical signals so that a single bound ligand molecule might produce a multitude of second messengers. Some recent work has focused on a particular feature present in some MAPK pathways -- a negative feedback loop which spans the length of the cascade. This is a feature that is shared by a man-made engineering device, the feedback amplifier. We propose a novel interpretation: that by wrapping a feedback loop around an amplifier, these cascades may be acting as biochemical feedback amplifiers which imparts i) increased robustness with respect to internal perturbations; ii) a linear graded response over an extended operating range; iii) insulation from external perturbation, resulting in functional modularization. We also report on the growing list of experimental evidence which supports a graded response of MAPK with respect to Epidermal Growth Factor. This evidence supports our hypothesis that in these circumstances MAPK cascade, may be acting as a feedback amplifier.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.