pith. sign in

arxiv: 0807.1514 · v2 · submitted 2008-07-09 · 🌊 nlin.PS

Generation of finite wave trains in excitable media

classification 🌊 nlin.PS
keywords excitablemediatrainswavefamilyfinitelocalizedone-time
0
0 comments X
read the original abstract

Spatiotemporal control of excitable media is of paramount importance in the development of new applications, ranging from biology to physics. To this end we identify and describe a qualitative property of excitable media that enables us to generate a sequence of traveling pulses of any desired length, using a one-time initial stimulus. The wave trains are produced by a transient pacemaker generated by a one-time suitably tailored spatially localized finite amplitude stimulus, and belong to a family of fast pulse trains. A second family, of slow pulse trains, is also present. The latter are created through a clumping instability of a traveling wave state (in an excitable regime) and are inaccessible to single localized stimuli of the type we use. The results indicate that the presence of a large multiplicity of stable, accessible, multi-pulse states is a general property of simple models of excitable media.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.