pith. sign in

arxiv: 0809.1447 · v1 · submitted 2008-09-08 · 🌌 astro-ph

Pixelization and Dynamic Range in Radio Interferometry

classification 🌌 astro-ph
keywords dynamicrangeeffectslimitwhenevengridlocated
0
0 comments X
read the original abstract

This study investigates some of the consequences of representing the sky by a rectangular grid of pixels on the dynamic range of images derived from radio interferometric measurements. In particular, the effects of image pixelization coupled to the CLEAN deconvolution representation of the sky as a set of discrete delta functions can limit the dynamic range obtained when representing bright emission not confined to pixels on the grid. Sky curvature effects on non-coplanar arrays will limit the dynamic range even if strong sources are centered on a pixel in a "fly's eye" representation when such pixel is not located at the corresponding facet's tangent point. Uncertainties in the response function of the individual antennas as well as in the calibration of actual data due to ionospheric, atmospheric or other effects will limit the dynamic range even when using grid-less subtraction (i.e. in the visibility domain) of strong sources located within the field of view of the observation. A technique to reduce these effects is described and examples from an implementation in the Obit package are given. Application of this technique leads to significantly superior results without a significant increase in the computing time.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.