pith. sign in

arxiv: 1009.4174 · v1 · pith:KOPUOV3Gnew · submitted 2010-09-21 · 🌌 astro-ph.SR

Generation of Longitudinal Flux Tube Waves in Theoretical Main-Sequence Stars: Effects of Model Parameters

classification 🌌 astro-ph.SR
keywords energymagneticstarsstellarwavefluxgenerationparameters
0
0 comments X
read the original abstract

Context. Continued investigation of the linkage between magneto-acoustic energy generation in stellar convective zones and the energy dissipation and radiative emission in outer stellar atmospheres in stars of different activity levels. Aims. We compute the wave energy fluxes carried by longitudinal tube waves along vertically oriented thin magnetic fluxes tubes embedded in the atmospheres of theoretical main-sequence stars based on stellar parameters deduced by R. L. Kurucz and D. F. Gray. Additionally, we present a fitting formula for the wave energy flux based on the governing stellar and magnetic parameters. Methods. A modified theory of turbulence generation based on the mixing-length concept is combined with the magneto-hydrodynamic equations to numerically account for the wave energies generated at the base of magnetic flux tubes. Results. The results indicate a stiff dependence of the generated wave energy on the stellar and magnetic parameters in principal agreement with previous studies. The wave energy flux F_LTW decreases by about a factor of 1.7 between G0V and K0V stars, but drops by almost two orders of magnitude between K0V and M0V stars. In addition, the values for F_LTW are significantly higher for lower in-tube magnetic field strengths. Both results are consistent with the findings from previous studies. Conclusions. Our study will add to the description of magnetic energy generation in late-type main-sequence stars. Our results will be helpful for calculating theoretical atmospheric models for stars of different levels of magnetic activity.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.