pith. sign in

arxiv: 1403.7155 · v2 · pith:B5TT56QSnew · submitted 2014-03-27 · 🌌 astro-ph.SR

Rotation and magnetism of Kepler pulsating solar-like stars. Towards asteroseismically calibrated age-rotation relations

classification 🌌 astro-ph.SR
keywords rotationstarsactivityrelationsdifferentdwarfskeplermagnetic
0
0 comments X
read the original abstract

Kepler ultra-high precision photometry of long and continuous observations provides a unique dataset in which surface rotation and variability can be studied for thousands of stars. Because many of these old field stars also have independently measured asteroseismic ages, measurements of rotation and activity are particularly interesting in the context of age-rotation-activity relations. In particular, age-rotation relations generally lack good calibrators at old ages, a problem that this Kepler sample of old-field stars is uniquely suited to address. We study the surface rotation and photometric magnetic activity of a subset of 540 solar-like stars on the main- sequence and the subgiant branch for which stellar pulsations have been measured. The rotation period was determined by comparing the results from two different analysis methods: i) the projection onto the frequency domain of the time-period analysis, and ii) the autocorrelation function (ACF) of the light curves. Reliable surface rotation rates were then extracted by comparing the results from two different sets of calibrated data and from the two complementary analyses. We report rotation periods for 310 out of 540 targets (excluding known binaries and candidate planet-host stars); our measurements span a range of 1 to 100 days. The photometric magnetic activity levels of these stars were computed, and for 61.5% of the dwarfs, this level is similar to the range, from minimum to maximum, of the solar magnetic activity. We demonstrate that hot dwarfs, cool dwarfs, and subgiants have very different rotation-age relationships, highlighting the importance of separating out distinct populations when interpreting stellar rotation periods. Our sample of cool dwarf stars with age and metallicity data of the highest quality is consistent with gyrochronology relations reported in the literature.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Asteroseismology of solar-type stars

    astro-ph.SR 2019-06 unverdicted novelty 2.0

    This review summarizes the development, techniques, and open questions in asteroseismology of solar-type stars whose oscillations are stochastically excited by surface convection.