pith. sign in

arxiv: 1602.06629 · v2 · pith:6CBZLZ3Fnew · submitted 2016-02-22 · 🧮 math.PR

Nested critical points for a directed polymer on a disordered diamond lattice

classification 🧮 math.PR
keywords alphabetakappawidehatsqrtvariancewhenfunction
0
0 comments X
read the original abstract

We consider a model for a directed polymer in a random environment defined on a hierarchical diamond lattice in which i.i.d. random variables are attached to the lattice bonds. Our focus is on scaling schemes in which a size parameter $n$, counting the number of hierarchical layers of the system, becomes large as the inverse temperature $\beta$ vanishes. When $\beta$ has the form $\widehat{\beta}/\sqrt{n}$ for a parameter $\widehat{\beta}>0$, we show that there is a cutoff value $0 < \kappa < \infty$ such that as $n \to \infty$ the variance of the normalized partition function tends to zero for $\widehat{\beta}\leq \kappa $ and grows without bound for $\widehat{\beta} > \kappa $. We obtain a more refined description of the border between these two regimes by setting the inverse temperature to $\kappa/\sqrt{n} + \alpha_n$ where $0 < \alpha_n \ll 1/\sqrt{n}$ and analyzing the asymptotic behavior of the variance. We show that when $\alpha_n = \alpha (\log n-\log \log n)/n^{3/2}$ (with a small modification to deal with non-zero third moment) there is a similar cutoff value $\eta$ for the parameter $\alpha$ such that when $\alpha < \eta$ the variance goes to zero and grows without bound when $\alpha > \eta$. Extending the analysis yet again by probing around the inverse temperature $\kappa/\sqrt{n} + \eta (\log n-\log \log n)/n^{3/2}$ we find an infinite sequence of nested critical points for the variance behavior of the normalized partition function. In the subcritical cases $\widehat{\beta} \leq \kappa$ and $\alpha \leq \eta$ this analysis is extended to a central limit theorem result for the fluctuations of the normalized partition function.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.