Stable mathbb{A}¹-connectivity over Dedekind schemes
classification
🧮 math.AG
math.AT
keywords
connectivitydedekindinfinitemathbbresiduedecreasesdiscreteestablish
read the original abstract
We show that $\mathbb{A}^1$-localization decreases the Nisnevich-stalkwise connectivity by at most one over a Dedekind scheme with infinite residue fields. For the proof, we establish a Nisnevich-local version of Gabber's geometric presentation lemma over a henselian discrete valuation ring with infinite residue field.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.