pith. sign in

arxiv: 1602.08356 · v3 · pith:S7IGO6E5new · submitted 2016-02-26 · 🧮 math.AG · math.AT

Stable mathbb{A}¹-connectivity over Dedekind schemes

classification 🧮 math.AG math.AT
keywords connectivitydedekindinfinitemathbbresiduedecreasesdiscreteestablish
0
0 comments X
read the original abstract

We show that $\mathbb{A}^1$-localization decreases the Nisnevich-stalkwise connectivity by at most one over a Dedekind scheme with infinite residue fields. For the proof, we establish a Nisnevich-local version of Gabber's geometric presentation lemma over a henselian discrete valuation ring with infinite residue field.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.