pith. sign in

arxiv: 1606.03447 · v1 · pith:RFS33N55new · submitted 2016-06-10 · 🧮 math.NT

On Pfaffian and determinant of one type of skew centrosymmetric matrices

Fatih Yilmaz , Tomohiro Sogabe , Emrullah Kirklar This is my paper
classification 🧮 math.NT
keywords centrosymmetricdeterminantmatricespfaffianskewtypecomputededicated
0
0 comments X
read the original abstract

This paper is dedicated to compute Pfaffian and determinant of one type of skew centrosymmetric matrices in terms of general number sequence of second order.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.