Pharmacokinetics Simulations for Studying Correlates of Prevention Efficacy of Passive HIV-1 Antibody Prophylaxis in the Antibody Mediated Prevention (AMP) Study
classification
🧬 q-bio.QM
stat.AP
keywords
adherenceantibodyeffectestimatesmarkerpharmacokineticspreventionsampling
read the original abstract
A key objective in two phase 2b AMP clinical trials of VRC01 is to evaluate whether drug concentration over time, as estimated by non-linear mixed effects pharmacokinetics (PK) models, is associated with HIV infection rate. We conducted a simulation study of marker sampling designs, and evaluated the effect of study adherence and sub-cohort sample size on PK model estimates in multiple-dose studies. With m=120, even under low adherence (about half of study visits missing per participant), reasonably unbiased and consistent estimates of most fixed and random effect terms were obtained. Coarsened marker sampling schedules were also studied.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.