pith. sign in

arxiv: 1805.04848 · v1 · pith:KTAQYU4Hnew · submitted 2018-05-13 · 🌌 astro-ph.HE

Energy accumulation mechanism in pulsar magnetospheric plasma eigen-waves and formation of Giant Radio Pulses

classification 🌌 astro-ph.HE
keywords energyplasmawavesfieldgiantlinesmagneticradio
0
0 comments X
read the original abstract

In the present work we consider energy accumulation mechanism in relativistic electron-positron plasma in the magnetosphere of pulsars. Waves propagating almost across the magnetic field lines are generated that accumulate the energy of plasma particles, as the waves stay significantly long in the resonance region. The accumulated energy is transmitted in the parallel direction of the magnetic field lines as soon as the non-linear plasma processes start to operate. It is suggested that exit of the accumulated energy via waves propagating along the magnetic field lines matching the viewing angle of the observer produces giant pulses. It is shown that these waves come in the radio domain, explaining the Giant Radio Pulse phenomenon.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.