pith. sign in

arxiv: 1811.12825 · v1 · pith:N4PWTNE5new · submitted 2018-11-30 · 🌌 astro-ph.GA

Praesepe white dwarfs in Gaia DR2

classification 🌌 astro-ph.GA
keywords whiteclustergaiapraesepedataderiveddwarfmass
0
0 comments X p. Extension
pith:N4PWTNE5 Add to your LaTeX paper What is a Pith Number?
\usepackage{pith}
\pithnumber{N4PWTNE5}

Prints a linked pith:N4PWTNE5 badge after your title and writes the identifier into PDF metadata. Compiles on arXiv with no extra files. Learn more

read the original abstract

We have exploited Gaia Data Release 2 to study white dwarf members of the Praesepe star cluster. We recovered eleven known white dwarf members (all DA spectral type) plus a new cluster WD never identified before. Two of the eleven known DA objects did not satisfy all quality indicators available in the data release. The remaining nine objects of known spectral type have then been employed to determine their masses (average error of 3-5%) and cooling times (average uncertainty of 5-7\%), by fitting cooling tracks to their colour-magnitude diagram. Assuming the recent Gaia Data Release 2 reddening and main sequence turn off age estimates derived from isochrone fitting, we have derived progenitor masses and established the cluster initial-final mass relation. We found consistency with the initial-final mass relation we established for eight Hyades white dwarfs, also employing Gaia data. We have investigated also the effect on the derived initial masses of using self-consistently different sets of stellar models and isochrones for determining cluster age and white dwarf progenitor lifetimes. According to our established Hyades+Praesepe initial-final mass relation, recent sets of stellar evolution calculation that model the full asymptotic giant branch phase do on average underpredict the final white dwarf masses, in the initial mass range covered by the Praesepe and Hyades observed cooling sequence. These results depend crucially on the assumed reddening for the cluster. To this purpose, we have also discussed the case of considering the traditional zero reddening for Praesepe, instead of E(B-V)=0.027 derived from isochrone fitting to the Gaia colour magnitude diagram.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.