pith. sign in

arxiv: 2407.04827 · v1 · pith:VTGOD7BInew · submitted 2024-07-05 · 🌌 astro-ph.SR

Massive White Dwarfs in the 100 pc Sample: Magnetism, Rotation, Pulsations, and the Merger Fraction

classification 🌌 astro-ph.SR
keywords whitesampledwarfsmassivefractionmergerodotmagnetic
0
0 comments X
read the original abstract

We present a detailed model atmosphere analysis of massive white dwarfs with $M > 0.9~M_\odot$ and $T_{\rm eff}\geq11,000$ K in the Montreal White Dwarf Database 100 pc sample and the Pan-STARRS footprint. We obtained follow-up optical spectroscopy of 109 objects with no previous spectral classification in the literature. Our spectroscopic follow-up is now complete for all 204 objects in the sample. We find 118 normal DA white dwarfs, including 45 massive DAs near the ZZ Ceti instability strip. There are no normal massive DBs: the six DBs in the sample are strongly magnetic and/or rapidly rotating. There are 20 massive DQ white dwarfs in our sample, and all are found in the crystallization sequence. In addition, 66 targets are magnetic (32% of the sample). We use magnetic white dwarf atmosphere models to constrain the field strength and geometry using offset dipole models. We also use magnetism, kinematics, and rotation measurements to constrain the fraction of merger remnant candidates among this population. The merger fraction of this sample increases from 25% for 0.9-$1~M_{\odot}$ white dwarfs to 49% for 1.2-$1.3~M_{\odot}$. However, this fraction is as high as $78_{-7}^{+4}$% for 1.1-$1.2~M_{\odot}$ white dwarfs. Previous works have demonstrated that 5-9% of high-mass white dwarfs stop cooling for $\sim8$ Gyr due to the $^{22}$Ne distillation process, which leads to an overdensity of Q-branch stars in the solar neighborhood. We demonstrate that the over-abundance of the merger remnant candidates in our sample is likely due to the same process.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.