Pith. sign in

REVIEW 2 major objections 5 minor 51 references

Crossover from Wannier-Stark localization to charge density waves for interacting spinless fermions in one dimension

T0 review · 2 major / 5 minor · reviewed 2026-08-08 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read For spinless fermions in a one-dimensional Wannier-Stark chain, the width of the partially filled edge between the occupied bulk and the empty vacuum grows as (2t+V)/(eF), and for nearest-neighbor repulsion V > 2t that edge develops into…

desk verdict Solid non-interacting analytics and a plausible CDW crossover, but the headline linear-in-V edge width is not established for strong interactions because the width measure drops the saturated CDW core. read the letter →

arxiv 2502.04866 v1 pith:2VWGI4QF submitted 2025-02-07 cond-mat.str-el

Nair Aucar Boidi , Amnon Aharony , Ora Entin-Wohlman , Karen Hallberg , Cesar Proetto This is my paper · ORCID
classification cond-mat.str-el
keywords Wannier-StarklocalizationchargedensitywavespinlessfermionsmatrixrenormalizationgroupBesselfunctionslengthone-dimensionallatticecoldatoms
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper studies spinless fermions on a finite one-dimensional lattice with a linear electric potential (Wannier-Stark ladder) and nearest-neighbor repulsion V. It aims to show that the intermediate 'edge' region, where the occupation falls from 1 to 0, has a width proportional to (2t+V)/(eF), growing linearly with the interaction and inversely with the field, and that for V > 2t this region becomes a half-filled charge density wave. For the non-interacting case, the paper provides exact Bessel-function expressions for the density profile, the localization lengths, and the local density of states, and confirms them against density matrix renormalization group numerics. The relevance is that cold-atom chains with a tunable potential slope could directly test this predicted scaling and the emergence of ordered CDW domains inside a confined system.

What carries the argument

The central object is the Wannier-Stark eigenfunction expansion b†_m = sum_j J_{j-m}(2t/(eF)) c†_j, which diagonalizes the non-interacting Hamiltonian and yields the occupation sum n_j(x) = sum_{m<=0} $J^{2}$_{m-j}(x) with x=2t/(eF). This Bessel-function machinery provides exact expressions for the density profile, the localization lengths (ξ1 = 4/F+1, ξ2 via the intermediate-filling window, ξ3 = 2√2 ξ̃ + 1 with ξ̃² = 2(t/F)², and the many-particle length ξ4), and the local density of states, all inversely proportional to F. For finite V, the same bandwidth argument that gives the V=0 edge (a site is partially filled when its potential lies between the effective band edges) is extended to -2t - V < μ_j < 2t + V, yielding the interacting width ξ_{1,int} = 2(2t+V)/(eF) + c. DMRG simulations then confirm that the numerically measured edge width ξ2 and many-particle length ξ4 collapse onto this linear-in-V, linear-in-1/F prediction, and that for V > 2t a CDW region with n_j n_{j+1} = 0 appears in the middle of the chain.

What would settle it

Calculate (or measure in a cold-atom chain) the width of the intermediate-filling region as a function of F for a fixed V>2t; if the width is not proportional to (2t+V)/F, or if no ...101010... CDW region appears around the chain center for V>2t at small F, the central claim fails.

Watch

Extended reading notes

Core claim

The paper establishes that in the ground state of the interacting Wannier-Stark chain, the domain wall between the fully occupied bulk and the empty vacuum is characterized by a single length scale: the width of the intermediate-filling region is 2(2t+V)/(eF) plus a constant of order one. In the non-interacting limit V=0, this reduces to 4t/(eF)+1, and the site occupations n_j = sum_{m<=0} J_{j-m}^2(2t/eF) of the infinite chain reproduce the finite-chain DMRG results exactly when the system is longer than the localization length. When V exceeds 2t, the middle of the chain, lying within the charge gap, orders into a ...101010... charge density wave whose spatial extent grows with V and shrinks with F, while remaining surrounded by the same linear edge. The local density of states evolves from a Wannier-Stark ladder of equally spaced peaks at V=0 into a broadened structure as V grows, consistent with the increased localization length.

Load-bearing premise

The edge width formula assumes the interacting ground state can be described by independent one-particle energies shifted by V, so the boundaries are where the local potential equals -2t - V and 2t + V; if many-body corrections shift these boundaries in a more complicated way with F, the linear scaling would fail.

Editorial extensions

If this is right

  • The width of the intermediate-filling edge in interacting Wannier-Stark chains is quantitatively predicted by a simple one-particle band-edge formula, so cold-atom measurements of the density profile can directly extract both t and V from the slope of width versus 1/F.
  • For V > 2t, a tunable electric field controls the spatial extent of a half-filled CDW domain inside the chain, offering a clean experimental knob to create or destroy ordered regions in a disorder-free system.
  • The Bessel-function expressions for the non-interacting occupation profile and LDOS are exact for infinite chains and remain accurate for finite chains as long as the localization length stays below the system size, providing a benchmark standard for numerical methods.
  • The linear scaling of the many-particle localization length with V/F implies that Stark many-body localization in this model is governed by the same single length scale as the non-interacting WS ladder, with interaction only renormalizing the prefactor.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The paper's bandwidth argument treats the interaction as a rigid shift of the band edges; a natural next step would be to test whether quantum fluctuations around the CDW boundary modify the effective edge position by a V-dependent constant or by logarithmic corrections at fixed F.
  • The same Bessel-function framework could be extended to spinful fermions or to next-nearest-neighbor interactions, where the phase diagram may contain additional CDW periodicities; the paper predicts these appear only at the uniform half-filling CDW for the spinless model.
  • The predicted linear scaling suggests a practical method to calibrate interaction strength in optical-lattice experiments: measuring the slope of the edge width versus inverse tilt gives (2t+V) directly, independent of the microscopic model details beyond nearest-neighbor terms.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

2 major / 5 minor

Summary. This manuscript studies spinless fermions on a finite one-dimensional chain with nearest-neighbor tunneling t, a linear potential F(j-jc), and nearest-neighbor repulsion V. In the noninteracting case, the authors derive exact Bessel-function expressions for the Wannier-Stark eigenstates, the ground-state site occupations, several localization-length measures, and the local density of states, and verify these against DMRG. For V>0, DMRG density profiles show a crossover from a smooth occupation edge to an edge containing a half-filled charge density wave for V>2t. The central quantitative claim is that the width of the intermediate edge region scales as 2(2t+V)/F, with numerical support from data collapses using two different width measures, xi2 and xi4.

Significance. The noninteracting part is a valuable exact benchmark: the Bessel-function representation, the various localization-length definitions, and the LDOS are worked out in detail and match DMRG. The interacting part provides a clear numerical scaling law for the edge width in a tilted fermionic chain and identifies a CDW-ordered central region, which is experimentally relevant for cold-atom implementations. The paper is reasonably transparent about the heuristic nature of Eq. (37), but the presentation does not always separate exact statements from fitted or empirical ones. If the definitional issues below are resolved, this would be a solid contribution to the Wannier-Stark and Stark-many-body-localization literature.

major comments (2)
  1. [Sec. IV.B.2, Eq. (22), Fig. 10] The definition of xi2 is ambiguous in the CDW regime, and this ambiguity is load-bearing for the main claim. Section III.D.2 first says xi2 counts sites with epsilon < n_j < 1 - epsilon, but Eq. (22) defines j_R as the largest site with n_j >= epsilon. These two definitions coincide for the monotone V=0 profile but not for the V>2t profiles in Figs. 7-8, where the 'edge' contains alternating sites with occupations close to 0 and 1. If the implemented definition is the one in Eq. (22), xi2 includes the high-density sites of the saturated CDW core and the linear growth with V in Fig. 10 is consistent with the growth of the CDW core; if the upper threshold 1 - epsilon is also enforced, xi2 measures only the two domain walls and would saturate for strong interactions. Since the central claim that the edge width is linear in V rests on Fig. 10, the authors should state precisely which rule was used and, ideally, show that the same linear scaling is obtained with an explicit width definition that counts the whole CDW-containing edge, including a check at larger V than the V<=5 range shown in Fig. 10.
  2. [Sec. IV.B.1, Eq. (37)] Eq. (37) is presented as an analytical expression for the interacting width, but the argument leading to it has an unstated step. The energies -2t-V and 2t+V are indeed the exact single-particle addition and hole-removal energies of the infinite chain for the interaction term of Eq. (5), so the energy range itself is not in question. What is assumed is that the local density in the many-body ground state changes across this energy range in the same way as in the noninteracting case; no derivation is provided for V different from 0. In addition, the constant c in Eq. (37) is left unspecified, while the figures compare with F(xi-1), which corresponds to c=1. I recommend stating that Eq. (37) is a heuristic estimate validated by DMRG, setting c=1 explicitly, and providing a quantitative test of the endpoint identification, for example by extracting the density endpoints from DMRG and comparing them with the solutions of mu_j = +/- (2t+V) for a few values of V.
minor comments (5)
  1. [Sec. III.D.2] The two threshold statements in this subsection should be reconciled: the text says sites with epsilon < n_j < 1 - epsilon, but Eq. (22) uses n_j >= epsilon. This matters for the CDW profiles and is related to the first major comment.
  2. [Sec. IV.B.2, Figs. 10 and 11] The captions say the dashed line indicates 'the scaled expression for the analytical expression xi1,int, Eq. (37)', but do not state that it is F(xi1,int - 1) with c=1. Please make the plotted quantity explicit in the captions and in the text.
  3. [Sec. III.E, Eq. (36)] In Eq. (36), the integration limit omega=0 corresponds to the chemical potential being zero, which follows from particle-hole symmetry at half-filling. This should be stated explicitly.
  4. [Appendix B] The last sentence of Appendix B, 'This does not give a linear xiA', is unclear. Please define xiA and explain how the straight line xitilde_xi = 0.9395x in Fig. 13 was obtained from the series expansion.
  5. [Sec. II, DMRG details] The DMRG section would benefit from reporting a representative truncation error or bond dimension for the largest system sizes; 'around five hundred states' is a useful but incomplete convergence statement for a paper whose central results are numerical.

Circularity Check

0 steps flagged · score 2.0 of 10

No significant circularity: the analytical non-interacting results are exact infinite-chain benchmarks, and the interacting width claims are compared against independent DMRG data rather than being forced by fitted inputs.

full rationale

The non-interacting sector is self-contained: Eq. (11) is the exact infinite-chain Bessel occupation expression taken from the external Ref. [20], and Eqs. (17), (26), and (35) are derived inside the paper from standard Bessel-function identities and then benchmarked against DMRG. The constants A4 = 2.13 and B4 = 0.88 in Eq. (29) are fitted at V = 0 to map the many-particle second moment onto xi1, but the same fixed constants are later applied to DMRG densities at V > 0 in Fig. 11; that is an out-of-sample comparison, not a fit to the quantity being predicted. Eq. (37) is an explicitly heuristic band-edge estimate based on the exact single-particle/hole addition energies -2t - V and 2t + V; it is not constructed from the numerical xi2 definition, so the agreement reported in Figs. 10 and 11 is not forced by construction. The concern that the epsilon = 0.02 threshold in the xi2 definition may exclude saturated CDW sites affects whether xi2 measures the full intermediate region for large V, but that is a measurement-matching or validity issue, not circularity. Self-citations to Refs. [3,4] appear in the band-edge argument, but the same reasoning is also attributed to Wei et al. [29] and is simple dimensional analysis, so it is not load-bearing. No step in the derivation chain reduces, by the paper's own equations, to its own inputs.

Assumptions & free parameters 3 free parameters · 4 assumptions · 0 invented entities

The central claim rests on the known WS Bessel solution for the non-interacting case, on a heuristic band-edge assumption for the interacting width, and on DMRG convergence. The free parameters are diagnostic constants in the definition of the localization length and region boundaries, not model parameters. No new physical entities are introduced.

free parameters (3)
  • A4, B4 = A4=2.13, B4=0.88
    Adjusted in Eq. (29) so that the many-particle localization length xi4 matches xi1 for the non-interacting case. Diagnostic constants, not physical parameters.
  • c in Eq. (37) = not specified, presumably 1
    The constant added to the interacting edge width in Eq. (37) is never determined; figures appear to use c=1 inherited from Eq. (20), but this is not stated.
  • epsilon thresholds = epsilon=0.02 for xi2, epsilon=0.001 for LCDW
    Thresholds chosen by hand to define the boundaries of the intermediate-filling region and the CDW region; the reported widths depend on these choices.
assumptions (4)
  • domain assumption Infinite-chain Bessel eigenfunctions of the Wannier-Stark Hamiltonian are used for finite chains when the localization length is smaller than the system size.
    Eq. (7) gives infinite-chain eigenstates; used to compute occupations and LDOS on finite chains, relying on the absence of finite-size effects.
  • domain assumption The ground state at half-filling is obtained by filling WS states m = -L/2+1 ... 0.
    Eq. (9) assumes particle-hole symmetry and that the half-filled ground state is the Slater determinant of the occupied WS states.
  • ad hoc to paper The interacting band boundaries are -2t - V and 2t + V.
    Eq. (37) bases the edge width on these effective one-particle energies; this is a heuristic, not derived from the many-body Hamiltonian.
  • domain assumption DMRG with about 500 kept states and fewer than a dozen sweeps converges to the ground state.
    Used for all interacting results; no convergence or truncation error analysis is provided.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Crossover from Wannier-Stark localization to charge density waves for interacting spinless fermions in one dimension." pith.science (2026). https://pith.science/paper/2VWGI4QF

@misc{pith2026250204866,
  author       = {Pith},
  title        = {Pith review of: Crossover from Wannier-Stark localization to charge density waves for interacting spinless fermions in one dimension},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/2VWGI4QF}},
  note         = {Machine review of arXiv:2502.04866}
}
read the original abstract

We study spinless fermions on a finite chain with nearest-neighbor repulsion and in the presence of a Wannier-Stark linearly-varying electric field potential. In the absence of the interaction, the eigenstates are localized for the system's sizes larger than the localization length. We present several analytical expressions for the localization length, which is proportional to the inverse of the electric field. Using the density matrix renormalization group numerical technique, we observe that the ground state exhibits a decrease of the occupation on the chain sites from the `bulk', with occupation 1, to the vacuum, with occupation 0. The width of this intermediate `edge' region is also inversely proportional to the electric field, increasing linearly with the strength of the nearest-neighbor repulsion. For strong interactions, the occupations in the intermediate region exhibit a charge density wave. We also present the local density of states for sites in the `edge' region. For the non-interacting case, the spectrum shows an increasing energy-localized structure as the field is increased, which is a consequence of the uniform energy distribution of the localized states (Wannier-Stark ladder). This structure survives for small interactions, and it smears out in the strongly interacting limit. Experimental variations of the slope of the potential (the electric field) on cold atom chains may test these predictions.

Figures

Figures reproduced from arXiv: 2502.04866 by the authors.

Figure 1
Figure 1. FIG. 1 [PITH_FULL_IMAGE:figures/full_fig_p003_1.png] view at source ↗
Figure 2
Figure 2. compares the site occupations derived ana￾lytically, Eq. (11) for j ≥ 0, and Eq. (15) for j < 0, with numerical results obtained by calculating the local occupation ⟨nj ⟩ for each site j, using the ground state, Eq. (9), found by the DMRG. The agreement is im￾pressive. An interesting feature of the plots is that for some particular values of the electric field, certain tiny plateaus seem to appear between two succes… view at source ↗
Figure 3
Figure 3. FIG. 3 [PITH_FULL_IMAGE:figures/full_fig_p005_3.png] view at source ↗
Figures from the paper (8 more)
Figure 6
Figure 6. Figure 6: presents the local (charge) occupations for a weak electric field F and weak interactions, V ≤ 2. As seen, there appear small oscillations in nj around the center of the chain as V increases. In the absence of an electric field, i.e., for a uniform chain, a charge dens…
Figure 5
Figure 5. Figure 5: As the electric field F increases, the oscillator strength becomes concentrated on a smaller number of peaks reflecting, in the frequency domain, the associated decreasing localization in real space of the Wannier-Stark eigenstates. For large electric fields, J 2 j−m(2…
Figure 7
Figure 7. Figure 7: FIG. 7 [PITH_FULL_IMAGE:figures/full_fig_p008_7.png]
Figure 8
Figure 8. Figure 8: FIG. 8 [PITH_FULL_IMAGE:figures/full_fig_p008_8.png]
Figure 10
Figure 10. Figure 10: FIG. 10 [PITH_FULL_IMAGE:figures/full_fig_p009_10.png]
Figure 12
Figure 12. Figure 12: FIG. 12 [PITH_FULL_IMAGE:figures/full_fig_p009_12.png]
Figure 13
Figure 13. Figure 13: FIG. 13 [PITH_FULL_IMAGE:figures/full_fig_p012_13.png]
Figure 14
Figure 14. Figure 14: FIG. 14 [PITH_FULL_IMAGE:figures/full_fig_p013_14.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

51 extracted references · 50 canonical work pages

  1. [1]

    [4]: For the non-interacting fermions, a certain site j is oc- cupied when µj ≲ − 2t band edge of the non-interacting system) and is empty for µj ≳ 2t

    Estimation based on the bandwidth One way to estimate the width of the intermediate- filling region follows by adapting the argument of Ref. [4]: For the non-interacting fermions, a certain site j is oc- cupied when µj ≲ − 2t band edge of the non-interacting system) and is empty for µj ≳ 2t. Exploiting Eq. (4), the two cases can be presented as µ< = eaF (...

    work page

  2. [2]

    Whether we use Eq

    Estimation based on the intermediate-filling region An alternative estimation of the intermediate-filling re- gion width is obtained by taking into account all sites with occupation ε < nj < 1 − ε, where ε ≪ 1. Whether we use Eq. (17) for the occupation nj at continuous j or the nj obtained by the DMRG, we can define jR > 0 as the largest site j whose fil...

    work page

  3. [3]

    Single-particle localization length A natural definition of the localization length of a single-particle wave function is given by its average 6 width, for example, for a particle with the quantum num- ber m = 0 (the definition being independent of this quan- tum number), ˜ξ = vuut ∞X j=−∞ j2pj(0) , (23) where pj(0) = J 2 j (2/F ) is the probability of fi...

    work page

  4. [4]

    Many-particle localization length We define the many-particle localization length as the mean-square distance of the charge distribution: ˜˜ξ = 2 sX j>0 (j − jc)2 ˜pj , (28) where pj(0) in Eq. (23) is replaced by ˜ pj ≡ nj/N , with N = P j′>0 nj′ being the total probability of finding elec- trons on the right-hand side of the chain (equal to the total num...

    work page

  5. [5]

    In- deed, Wei et al

    Derivation based on the bandwidth of the Hamiltonian with interactions Dimensional analysis implies that any typical length should be a linear combination of t/eaF and V /eaF. In- deed, Wei et al. [29] use arguments similar to ours in Sec. III D 1 to obtain an estimation of the width of this cen- tral region. For V ̸= 0, the ‘band boundaries’ can be estim...

    work page

  6. [6]

    Comparison with the intermediate-filling region ξ2 [Eq. (22)] Figure 10 exhibits the results of the width of the inter- acting intermediate region where the numerically calcu- 9 0 5 10 15 20 25 0 1 2 3 4 5 F (ξ1,int − 1) F = 0.13 F = 0.20 F = 0.25 F = 0.50 F (ξ2 − 1) V FIG. 10: Scaled characteristic length ξ2 [Eq. (22)] obtained from the width of the inte...

    work page

  7. [7]

    (29)] for small V

    Comparison with the many-particle localization length ξ4 [Eq. (29)] for small V . For V ≤ 2t the site occupations in Fig. 6 are still qualitatively similar to those in the non-interacting case, except for the existence of density fluctuations within the intermediate region. As for this parameter range, there is no CDW, its width can be estimated using Eq....

    work page

  8. [8]

    11: Characteristic length ξ4 [Eq

    Local densities of state The effect of a weak interaction on the localization length can also be observed in the structure of the lo- 0 10 20 30 40 50 60 70 80 90 0 1 2 3 4 5 6 7 8 0 5 10 15 0 0 .25 0 .5 0 .75 1 V = 0.00 V = 0.25 V = 0.50 V = 1.00 ξ4 1/F F (ξ1,int − 1) F = 0.13 F = 0.20 F = 0.25 F = 0.50 F (ξ4 − 1) V FIG. 11: Characteristic length ξ4 [Eq....

    work page

Show all 51 references
  1. [9]

    The correction to the leading contribution comes from the choice j −m1 = ±1, m2 = m3 = m4 = j, and the three equivalent choices obtained by exchanging the indexes m1, m2, m3, m4

    → 1−z2/4+ .... The correction to the leading contribution comes from the choice j −m1 = ±1, m2 = m3 = m4 = j, and the three equivalent choices obtained by exchanging the indexes m1, m2, m3, m4. In summary, in the strong-field limit, it is permissible to expand the range functi...

  2. [10]

    Bloch, J

    I. Bloch, J. Dalibard, and W. Zwerger, Many-body physics with ultracold gases, Rev. Mod. Phys. 80, 885 (2008)

    2008

  3. [11]

    X. W. Guan, M. Batchelor, and C. Lee, Fermi gases in one dimension: From Bethe Ansatz to experiments, Rev. Mod. Phys. 85, 1633 (2013)

    2013

  4. [12]

    Khanna, Y

    U. Khanna, Y. Gefen, O. Entin-Wohlman, and A. Aharony, Edge Reconstruction of a Time-Reversal In- variant Insulator: Compressible-Incompressible Stripes, Phys. Rev. Lett. 128, 186801 (2022) and references therein

    2022

  5. [13]

    Aucar Boidi, K

    N. Aucar Boidi, K. Hallberg, Amnon Aharony, and Ora Entin-Wohlman, Coexistence of insulating phases in con- fined fermionic chains with a Wannier-Stark potential, Phys. Rev. B 109, L041404, (2024)

    2024

  6. [14]

    Ching, Exploring Unique Characteristics in Stark Many-Body Localization,arXiv:2501.10211

    C. Ching, Exploring Unique Characteristics in Stark Many-Body Localization,arXiv:2501.10211

    arXiv

  7. [15]

    P. W. Anderson, in Concepts in Solids (Addison-Wesley, 1963), p. 82

    1963

  8. [16]

    P. L. Taylor, in A quantum approach to the solid state (Prentice-Hall, 1970), p. 160

    1970

  9. [17]

    N. W. Ashcroft and N. D. Mermin, in Solid State Physics (Holt, Rinehart and Winston, 1976), p. 224

    1976

  10. [18]

    G. H. Wannier, in Elements of Solid State Theory (Cam- bridge U. P, England, 1959); wave functions and Effec- tive Hamiltonian for Bloch Electrons in an Electric Field, Phys. Rev. 117, 432 (1960); Dynamics of Band Electrons in Electric and Magnetic Fields, Rev. Mod. Phys. 34, ...

    1960

  11. [19]

    Gl ¨uck, A

    M. Gl ¨uck, A. R. Kolovsky, and H. J. Horsch, Wannier- Stark resonances in optical and semiconductor superlat- tices, Phys. Rep. 366, 103 (2002)

    2002

  12. [20]

    Waschke, H

    C. Waschke, H. G. Roskos, R. Schwedler, K. Leo, H. Kurz, and K. Kohler, Coherent submillimiter-wave emis- sion from Bloch oscillations in semiconductor superlat- tices, Phys. Rev. Lett. 70, 3319 (1993)

    1993

  13. [21]

    E. E. Mendez and G. Bastard, Wannier-Stark Ladders and Bloch Oscillations in Superlattices, Phys. Today 46, 34 (1993)

    1993

  14. [22]

    Q. Guo, C. Cheng, H. Li, S. Xu, P. Zhang, Z. Wang, C. Song, W. Liu, W. Ren, H. Dong, R. Mondaini, and H. Wang, Stark many-body localization on a supercon- ducting quantum processor, Phys. Rev. Lett. 127, 240502 (2020)

    2020

  15. [23]

    Wang, Z.-H

    Y.-Y. Wang, Z.-H. Sun, and H. Fan, Stark many-body localization transitions in superconducting circuits, Phys. Rev. B 104, 205122 (2021)

    2021

  16. [24]

    Ben Dahan, E

    M. Ben Dahan, E. Peik, J. Reichel, Y Castin, and C. Sa- lomon, Bloch oscillations of atoms in an optical potential, Phys. Rev. Lett. 76, 4508 (1996)

    1996

  17. [25]

    S. R. Wilkinson, C. F. Bharucha, K. W. Madison, Q. Niu, and M. G. Raizen, Observation of atomic Wannier-Stark ladders in an accelerating optical potential, Phys. Rev. Lett. 76, 4512 (1996)

    1996

  18. [26]

    B. P. Anderson and M. A. Kasevich, Macroscopic quan- tum interference from atomic tunnel arrays, Science 282, 14 1686 (1998)

    1998

  19. [27]

    Yao and J

    R. Yao and J. Zakrzewski, Many-body localization of bosons in an optical lattice: Dynamics in disorder-free potentials, Phys. Rev. B 102, 104203 (2020)

    2020

  20. [28]

    H. Lang, P. Hauke, J. Knolle, F. Grusdt, and J. C. Hal- imeh, Disorder-free localization with Stark gauge protec- tion, Phys. Rev. B 106, 174305 (2022)

    2022

  21. [29]

    Fukuyama, R.A

    H. Fukuyama, R.A. Bari and H. C. Fogedby, Tightly Bound Electrons in a Uniform Electric Field, Phys. Rev. B 8, 5579 (1973)

    1973

  22. [30]

    Dwiputra and F

    D. Dwiputra and F. P. Zen, Single-particle mobility edge without disorder, Phys. Rev. B 105, L081110 (2022)

    2022

  23. [31]

    Gao et al., Coexistence of extended and localized states in finite-sized mosaic Wannier-Stark lattices, Phys

    J. Gao et al., Coexistence of extended and localized states in finite-sized mosaic Wannier-Stark lattices, Phys. Rev. B 108, L402202 (2023)

    2023

  24. [32]

    Simon and T

    B. Simon and T. Spencer, Trace class perturbations and the absence of absolutely continuous spectra, Commun. Math. Phys. 125, 113 (1989)

    1989

  25. [33]

    Longhi, Absence of mobility edges in mosaic Wannier- Stark lattices, Phys

    S. Longhi, Absence of mobility edges in mosaic Wannier- Stark lattices, Phys. Rev. B 108, 064206 (2023)

    2023

  26. [34]

    Merlin, Phonon Bloch Oscillations, Phys

    R. Merlin, Phonon Bloch Oscillations, Phys. Rev. Lett. 132, 246302 (2024)

    2024

  27. [35]

    M. Schultz. C. A. Hooley, R. Moessner, and F. Poll- mann, Stark Many-Body Localization, Phys. Rev. Lett. 122, 040606 (2019)

    2019

  28. [36]

    E. P. L. van Nieuwenburg, Y. Baum and G. Refael, From Bloch Oscillations to Many Body Localization in Clean Interacting Systems Proc. Natl. Acad. Sci. USA116, 9269 (2019)

    2019

  29. [37]

    Morong et al., Observation of Stark many-body lo- calization without disorder, Nature 599, 393 (2021)

    W. Morong et al., Observation of Stark many-body lo- calization without disorder, Nature 599, 393 (2021)

    2021

  30. [38]

    K. Wei, X. Gao, and W. Zhu, Static and dynamical Stark many-body localization transition in a linear potential, Phys. Rev. B 106, 134207 (2022)

    2022

  31. [39]

    D. A. Abanin, E. Altman, I. Bloch, and M. Serbyn,Collo- quium: Many-body localization, thermalization, and en- tanglement, Rev. Mod. Phys. 91, 021001 (2019)

    2019

  32. [40]

    S. R. White, Density Matrix Formulation for Quan- tum Renormalization Group, Phys. Rev. Lett. 69, 2863 (1992)

    1992

  33. [41]

    Hallberg, New trends in density matrix renormaliza- tion, Adv

    K. Hallberg, New trends in density matrix renormaliza- tion, Adv. Phys. 55, 477 (2006)

    2006

  34. [42]

    Schollw ¨ock , The density-matrix renormalization group in the age of matrix product states, Ann

    U. Schollw ¨ock , The density-matrix renormalization group in the age of matrix product states, Ann. Phys. 326, 96 (2011)

    2011

  35. [43]

    Abramowitz and I

    M. Abramowitz and I. A. Stegun, Handbook of Mathe- matical Functions Dover Publications, New York, 1972

    1972

  36. [44]

    P. A. Martin, On functions defined by sums of products of Bessel functions, J. Phys. A: Math. Theor. 41, 015207 (2008). In particular, we have used Eq. (13) there

    2008

  37. [45]

    This expression tends to [ln (F/t)]−1 in the large electric field limit, and t/F in the weak field limit

    Reference [27] states (without derivation) that the local- ization length for the single-particle eigenstate |m = 0 ⟩ is proportional to [2 sinh −1(1/x)]−1, with x = 2/F . This expression tends to [ln (F/t)]−1 in the large electric field limit, and t/F in the weak field limit

  38. [46]

    J. H. Davies and J. W. Wilkins, Narrow electronic bands in high electric fields: Static properties, Phys. Rev. B 38, 1667 (1988)

    1988

  39. [47]

    Ramasesha, Swapan K

    S. Ramasesha, Swapan K. Pati, H.R. Krishnamurthy, Z. Shuai and J.L. Br´ edas, Low-lying electronic excita- tions and nonlinear optic properties of polymers via sym- metrized density matrix renormalization group method, Synthetic Metals 85, 1019, (1997)

    1997

  40. [48]

    Aucar Boidi, K

    N. Aucar Boidi, K. Hallberg, Amnon Aharony, and Ora Entin-Wohlman, SM of Phys. Rev. B 109, L041404, (2024)

    2024

  41. [49]

    Gotta, L

    L. Gotta, L. Mazza, P. Simon, and G. Roux, Pairing in spinless fermions and spin chains with next-nearest neighbor interactions, Phys. Rev. Res. 3, 013114 (2021)

    2021

  42. [50]

    Udono, T

    M. Udono, T. Kaneko, and K. Sugimoto, Wannier-Stark ladders and Stark shifts of excitons in Mott insulators, Phys. Rev. B 108, L081304 (2023)

    2023

  43. [51]

    Krajewski and M

    B. Krajewski and M. Mierzejewski, Dependence of the charge transport in tilted chains on the choice of two- body interaction, arXiv.2409.18484

    arXiv

Pith tools

Reviewed August 8, 2026 · model on record in the stance chip above.