Pith. sign in

REVIEW 3 cited by

Analysis of Helium-Rich White Dwarfs Polluted by Heavy Elements in the Gaia Era

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1907.05932 v1 pith:MI2D754P submitted 2019-07-12 astro-ph.SR

classification astro-ph.SR
keywords whitegaiadwarfsstarsanalysisdwarfheavymass
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

We present a homogeneous analysis of 1023 DBZ/DZ(A) and 319 DQ white dwarf stars taken from the Montreal White Dwarf Database. This represents a significant increase over the previous comprehensive studies on these types of objects. We use new trigonometric parallax measurements from the Gaia second data release, together with photometry from the Sloan Digital Sky Survey, Pan-STARRS, Gaia, or BVRI from the literature, which allow the determination of the mass for the majority of the objects in our sample. We use the photometric and spectroscopic techniques with the most recent model atmospheres available, which include high-density effects, to accurately determine the effective temperature, surface gravity, and heavy element abundances for each object. We study the abundance of hydrogen in DBZ/DZ white dwarfs and the properties of the accreted planetesimals. We explore the nature of the second sequence of DQ stars using proper motions from Gaia, and highlight evidence of crystallization in massive DQ stars. We also present mass distributions for both spectral types. Finally, we discuss the implications of our findings in the context of the spectral evolution of white dwarfs, and provide the atmospheric parameters for each star.

Discussion (0). Sign in to comment.

Forward citations

Cited by 3 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Magnetically guided accretion and extremely slow rotation in a metal-enriched white dwarf

    astro-ph.SR 2026-07 conditional novelty 7.0 of 10

    WD 1532+129 rotates once every ~289 days — the slowest directly measured spin of any white dwarf — and its accreted metals sit in patches at both magnetic poles.

  2. First planetesimals from DESI DR1: 12 highly metal-rich white dwarfs

    astro-ph.EP 2026-07 conditional novelty 6.0 of 10

    Twelve white dwarfs from DESI DR1 have accreted debris resembling inner-Solar-System rock, with two systems likely accreting water-rich planetesimals.

  3. White dwarfs within 13 pc: Insights from ultraviolet spectroscopy

    astro-ph.SR 2026-07 conditional novelty 6.0 of 10

    UV spectroscopy of the 44 nearest white dwarfs reveals a 2–6% temperature discrepancy between UV and optical model fits, six UV-only metal detections, and a 30% planetary debris accretion rate.

Pith tools