Pith. sign in

REVIEW

Bakry-\'Emery curvature sharpness and curvature flow in finite weighted graphs. I. Theory

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2204.10064 v2 pith:FYEDOM3X submitted 2022-04-21 math.CA math.COmath.DGmath.PR

classification math.CAmath.COmath.DGmath.PR
keywords curvatureflowbakry-emerygraphsweightedcaseedges
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

In this sequence of two papers, we introduce a curvature flow on (mixed) weighted graphs which is based on the Bakry-\'Emery calculus. The flow is described via a time-continuous evolution through the weighting schemes. By adapting this flow to preserve the Markovian property, its limits turn out to be curvature sharp. Our aim is to present the flow in the most general case of not necessarily reversible random walks allowing laziness, including vanishing transition probabilities along some edges ("degenerate" edges). This approach requires to extend all concepts (in particular, the Bakry-\'Emery curvature related notions) to this general case and it leads to a distinction between the underlying topology (a mixed combinatorial graph) and the weighting scheme (given by transition rates). We present various results about curvature sharp vertices and weighted graphs as well as some fundamental properties of this new curvature flow. This paper is accompanied by a second paper discussing the curvature flow implementation in Python for practical use. In this second paper we present examples and exhibit further properties of the flow.

Discussion (0). Continue with ORCID to comment.

Pith tools