Pith. sign in

REVIEW 1 cited by

Flow-TSVAD: Target-Speaker Voice Activity Detection via Latent Flow Matching

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2409.04859 v2 pith:EF5G2XVK submitted 2024-09-07 cs.SD eess.AS

classification cs.SDeess.AS
keywords diarizationgenerativeresultsalgorithmflow-tsvadspeakeractivityapplying
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

Speaker diarization is typically considered a discriminative task, using discriminative approaches to produce fixed diarization results. In this paper, we explore the use of neural network-based generative methods for speaker diarization for the first time. We implement a Flow-Matching (FM) based generative algorithm within the sequence-to-sequence target speaker voice activity detection (Seq2Seq-TSVAD) diarization system. Our experiments reveal that applying the generative method directly to the original binary label sequence space of the TS-VAD output is ineffective. To address this issue, we propose mapping the binary label sequence into a dense latent space before applying the generative algorithm and our proposed Flow-TSVAD method outperforms the Seq2Seq-TSVAD system. Additionally, we observe that the FM algorithm converges rapidly during the inference stage, requiring only two inference steps to achieve promising results. As a generative model, Flow-TSVAD allows for sampling different diarization results by running the model multiple times. Moreover, ensembling results from various sampling instances further enhances diarization performance.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Sequence-to-Sequence Neural Diarization with Automatic Speaker Detection and Representation

    eess.AS 2024-11 conditional novelty 7.0 of 10

    A single sequence-to-sequence network with detection and representation decoders achieves state-of-the-art online and offline speaker diarization on DIHARD-II and DIHARD-III.

Pith tools