Pith. sign in

REVIEW 1 cited by

Finite-Difference Time-Domain Simulation of Wave Transmission Through Space-Time-Varying Media

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2409.19923 v2 pith:2HZ6CTIE submitted 2024-09-30 physics.optics physics.app-ph

classification physics.opticsphysics.app-ph
keywords mediaspace-time-varyingelectricalfdtdtimewaveacrossalong
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

A comprehensive study on the Finite Difference Time Domain (FDTD) numerical modelling of space- and time-varying media is presented. We investigate the dynamic behavior of oblique incidence of both TM and TE electromagnetic fields on space-timemodulated gratings. In their general form, these media have electrical permittivity, magnetic permeability, and electrical conductivity modulated across both space and time. We provide the FDTDschemes, the Courant-Friedrichs-Lewy (CFL) stability condition and equations for both TM and TE wave illuminations of space-time-varying slabs, along with the boundary conditions for the FDTD scheme. Furthermore, with engaging illustrative examples, we showcase the versatility and applications of space-time-varying media.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Light Interaction With a Space-Time-Modulated Josephson Junction Array and Application to Angular-Frequency Beam Multiplexing

    cond-mat.supr-con 2025-01 reject novelty 4.0 of 10

    A space-time-modulated Josephson junction array is claimed to split an incoming microwave beam into frequency-shifted beams at different angles, but the analytic support is invalidated by a Fourier-coefficient error.

Pith tools