Pith. sign in

REVIEW 2 major objections 4 minor 1 cited by

Highly efficient, tunable, electro-optic metasurfaces based on quasi-bound states in the continuum

T0 review · 2 major / 4 minor · reviewed 2026-08-12 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read A thin lithium niobate metasurface reaches 95% modulation depth at 125 MHz, driven by a ±30 V bias.

desk verdict Measured results are credible and useful; the 39 GHz ultrafast projection is unsupported and needs to be toned down or fully derived. read the letter →

arxiv 2412.01449 v2 pith:L4PQ5DY2 submitted 2024-12-02 physics.optics physics.app-ph

Christopher Damgaard-Carstensen , Torgom Yezekyan , Mark L. Brongersma , Sergey I. Bozhevolnyi This is my paper · ORCID
classification physics.opticsphysics.app-ph
keywords electro-opticmetasurfacequasi-boundstatesinthecontinuumlithiumniobatePockelseffectfree-spaceintensitymodulationtelecomwavelengthsangle-tunableresonancephasecontrastimaging
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper reports a free-space intensity modulator built from a thin lithium niobate film on a gold back-reflector, topped by a grating of gold nanoridges that also serves as the control electrode. The design uses a quasi-bound state in the continuum (qBIC), a very narrow guided-mode resonance, to make reflected light strongly sensitive to the refractive-index change produced by the Pockels effect. The authors claim a measured modulation depth of 95% (35% of the total incident power) at a ±30 V bias, with a -3 dB electrical bandwidth of 125 MHz, at telecom wavelengths around 1550 nm. They further show that the resonance is angle-tunable over more than 30 nm and use the device for electrically switchable phase contrast imaging. If these results hold, the configuration is a practical route to thin, fast, free-space spatial light modulators.

What carries the argument

The central object is the quasi-bound state in the continuum (qBIC), a very narrow guided-mode resonance formed in a symmetric gold grating on a thin lithium niobate film when first-order grating coupling ($\lambda_{\text{eff}} = \Lambda$) and second-order Bragg reflection ($2\Lambda = 2\lambda_{\text{eff}}$) hold together. This creates a distributed Bragg resonator whose mode field sits mainly under the gold stripes, producing a sharp reflection dip at about 1550 nm. Applying a voltage between the grating electrode and the gold back-reflector changes the lithium niobate refractive index through the Pockels effect ($\Delta n \simeq \tfrac12 n^3 r_{hk} V/d$), shifting the dip; tuning the angle of incidence moves the whole resonance. The design targets critical coupling, equal scattering and absorption losses, so that the resonance can fully absorb the incoming light and the relative modulation approaches 100%.

What would settle it

Fabricate a 22 µm-pixel version of the gold-electrode configuration and measure its -3 dB electrical cutoff; if it stays well below 39 GHz, or if the small-pixel reflection dip is not at critical coupling, the projection is refuted. A complementary check is to measure the series resistance of the contact and grating lines to see whether resistance, not geometric capacitance, sets the 125 MHz cutoff of the current device.

Watch

Extended reading notes

Core claim

The central claim is that combining a qBIC resonance with the Pockels effect in a lithium niobate-on-gold configuration produces efficient free-space intensity modulation at telecom wavelengths. A symmetric grating of gold ridges excites two counter-propagating waveguide modes via first-order diffraction, and second-order Bragg reflection forms a distributed Bragg resonator; the resulting qBIC appears as a narrow reflection dip at about 1554 nm. A ±30 V bias shifts this dip by roughly 2.5 nm, giving an absolute modulation of 35% and a modulation depth up to 95%. The measured cutoff frequency is 125 MHz for the large top electrode and 350 MHz for a compact electrode, and the authors estimate that a 22 µm pixel would reach 39 GHz if the RC limit scales with electrode area. The same resonance enables angle-tunable operation and a proof-of-concept switchable phase contrast image.

Load-bearing premise

The speed projection rests on the assumption that the electrical bandwidth is set only by the electrode's lumped capacitance, so shrinking the electrode to a 22 µm pixel raises the -3 dB cutoff to 39 GHz, with that pixel also assumed to sit at critical coupling with an effective mode index of 2.

Editorial extensions

If this is right

  • Intensity modulation of a free-space beam at telecom wavelengths can be done with an 880 nm lithium niobate layer plus a gold grating, with no external cavity.
  • The same device acts as an electrically switchable phase-contrast element: at resonance it suppresses paraxial rays and leaves oblique rays nearly untouched.
  • One fabricated grating covers a 30 nm wavelength range by changing the angle of incidence by about 1 degree, with modulation depth of 30–40%.
  • The estimated 22 µm pixel size and 39 GHz bandwidth projection, if the RC scaling holds, would put this design in the regime needed for harmonic beam steering and spatiotemporal shaping.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Beyond the paper: the 39 GHz number is a projection that assumes the lumped electrode capacitance alone sets the cutoff and that a tiny pixel inherits the critical-coupling condition; neither assumption is experimentally verified here.
  • Beyond the paper: because the simulated phase swing exceeds 180 degrees at the resonance, a similar structure operated away from the reflection minimum could be used as a phase modulator, not only an intensity modulator.
  • Beyond the paper: a direct test of the scaling model would be to fabricate a single 22 µm pixel and measure its -3 dB electrical cutoff; any contact-resistance or pad-capacitance limit would show up as a far lower frequency.
  • Beyond the paper: the grating period and lithium niobate thickness set the qBIC wavelength, so the same design can be scaled to other telecom bands by adjusting the period.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

2 major / 4 minor

Summary. The paper reports reflection-mode electro-optic metasurfaces based on quasi-bound states in the continuum (qBIC) in a gold/lithium-niobate (LN) platform. The authors design, fabricate, and characterize symmetric and asymmetric gold gratings on an 880 nm z-cut LN film with a gold back-reflector. The fabricated device achieves 95% modulation depth (35% absolute modulation of incident power) at ±30 V bias, an electrical -3 dB bandwidth of 125 MHz (350 MHz with a more compact electrode), wavelength tunability over more than 30 nm by varying the angle of incidence, and a proof-of-concept electrically tunable phase-contrast imaging demonstration. The paper also projects a potential 39 GHz bandwidth for a 22 µm pixel size based on an RC-area-scaling argument and a critical-coupling assumption.

Significance. If the measured claims hold, this is a notable advance in free-space electro-optic intensity modulation, combining near-unity relative modulation depth with MHz-scale speed, telecom-wavelength operation, and angle tunability. The central experimental results are direct measurements, are internally consistent with finite-grating simulations, and are well documented in the Methods. The 35% absolute modulation and 125/350 MHz bandwidths are credible and represent a significant step beyond prior ITO-based metasurface modulators. The 39 GHz projection, however, is an extrapolation based on assumptions that are not fully verified, and it currently overstates the demonstrated performance.

major comments (2)
  1. [Abstract and Results (Dynamic characterization)] The 39 GHz bandwidth projection is not supported by the data presented. The argument assumes that the -3 dB cutoff is set purely by the electrode capacitance and scales inversely with electrode area, but no equivalent circuit, electrode dimensions, series/contact resistances, pad capacitances, or probe parasitics are given. The only experimental points are 125 MHz for the macroscopic electrode and 350 MHz for the compact electrode. A naive area scaling from the stated grating size (90 µm × 60 µm) to a 22 µm × 22 µm pixel would give a cutoff near 3.9 GHz, an order of magnitude below 39 GHz, unless additional area reductions of the bottom electrode are assumed. Since neither the electrode geometry nor the scaling model is specified, the 39 GHz number in the Abstract and Discussion cannot be checked and should be either substantiated with a concrete RC model and electrode layout or removed.
  2. [Results (Eq. (2) and pixel-size estimate)] The 22 µm pixel size used for the 39 GHz projection is derived from Eq. (2) under the assumptions of critical coupling (QU = 2 QL) and an effective mode index of 2. However, the authors state in 'Design and optimization of metasurface' that the fabricated finite grating is shifted away from critical coupling (Supplementary Fig. S4). Because the realized device is not critically coupled, the unloaded Q used in Eq. (2) does not correspond to the measured device, so the resulting pixel size and hence the bandwidth projection are not grounded in the experimental realization. The measured 125 MHz and 350 MHz bandwidths are unaffected by this issue, but the 39 GHz claim relies on an assumption that is known to be violated.
minor comments (4)
  1. [Title and Abstract] The rendering of the title and abstract contains missing spaces ('Highlyefficient', 'electro-opticmetasurfaces'); these should be corrected in the final version.
  2. [Results (Design and optimization of metasurface)] The FOM comparison is made against the authors' own previous value of 0.046. While this is legitimate, placing the new FOM (0.47 and 0.30) in the context of other free-space EO metasurface modulators would strengthen the claim of order-of-magnitude improvement.
  3. [Results (Dynamic characterization)] The measured absolute modulation (35%) is lower than the simulated 50%. The qualitative attribution to finite-grating effects is plausible, but the paper does not quantify how the finite grating reduces the modulation. Extracting an effective Q or modulation from the measured spectrum and comparing it with the finite-grating simulation would make the discussion more rigorous.
  4. [Results (Dynamic characterization)] The statement that the electrical bandwidth is limited by the electrode size is not backed by any dimensions for the macroscopic or compact electrodes. Providing approximate electrode areas and capacitances would allow readers to evaluate the RC scaling more directly.

Circularity Check

0 steps flagged · score 1.0 of 10

No significant circularity: the measured core claims are direct experiments checked against independent COMSOL simulations, and the 22 µm / 39 GHz figures are explicitly labeled estimates rather than circular predictions.

full rationale

The paper's central experimental claims—95% modulation depth, 35% absolute modulation at ±30 V, and the 125 MHz / 350 MHz electrical bandwidths—are direct measurements, and the static spectra are reproduced by independent COMSOL simulations using literature permittivities and Pockels coefficients from Jazbinšek et al. These results do not reduce to the paper's own definitions or fitted parameters. The design framework and FOM metric are drawn from the authors' prior work (refs. 38, 39), and the FOM improvement is benchmarked against their own prior value of 0.046; this is normal self-referential benchmarking, not a load-bearing circular step, because the qBIC resonance concept is also supported by external references [40, 41] and the comparisons are quantitative, not definitional. The 22 µm pixel size and 39 GHz bandwidth projections are explicitly introduced as estimates: the pixel size follows from Eq. (2) under the stated assumptions of n_eff = 2 and critical coupling (Q_U = 2 Q_L), and the 39 GHz figure is presented as a potential from further electrode miniaturization rather than as a measured or uniquely derived result. These are unverified extrapolations and assumptions—consistent with the skeptic's caveats about the finite grating being off critical coupling—but they are not circular reductions of the sort where an equation equals its input by construction or a fitted parameter is renamed as a prediction. No uniqueness theorem is imported from the authors' prior work, and no ansatz is smuggled in via citation. Therefore, no specific circular step can be identified, and the score reflects only the presence of minor, non-load-bearing self-citations in the design context.

Assumptions & free parameters 4 free parameters · 3 assumptions · 0 invented entities

The paper's central claims are experimental, so the ledger is light. The main hand-set values are the geometric design parameters (swept to target the telecom band and critical coupling) and the two assumptions used for the pixel-size and bandwidth projection: an effective mode index of 2 and QU = 2 QL at critical coupling. No new physical entities are introduced; material parameters come from standard literature sources.

free parameters (4)
  • Grating period Λ = 750 nm = 750 nm
    Chosen to place the qBIC resonance near the 1550 nm telecom band; a design target rather than a fit to measured data.
  • Ridge width w and thickness tg (symmetric grating) = w = 445 nm, tg = 75 nm
    Swept in simulation to reach critical coupling; design optimization, not a fit to the measured spectrum.
  • Effective mode refractive index assumed in Eq. (2) = n_eff approximately 2
    Hand-assumed value used to convert the unloaded Q factor into propagation length and the 22 µm pixel-size estimate.
  • Critical-coupling factor QU = 2 QL = QU approximately 360 from QL approximately 180
    Assumes equal absorption and scattering losses. The fabricated finite grating is shifted away from critical coupling (Supplementary Fig. S4), so the pixel-size estimate inherits this assumption.
assumptions (3)
  • domain assumption COMSOL FEM with periodic boundary conditions and literature permittivities for Au, Cr, and LN faithfully models the fabricated device.
    All simulated spectra, Q factors, and modulation predictions rely on this. The authors switch to a finite-grating model with N = 120 after the infinite model failed to match the measured broad resonance.
  • domain assumption The observed modulation is entirely due to the linear electro-optic (Pockels) effect in LN with r33 = 31.45 pm/V and r13 = 10.12 pm/V.
    The two-step electro-optic simulation applies only the Pockels index change. Agreement with measured modulation supports, but does not fully isolate, other possible mechanisms such as thermal, carrier, or electro-absorption effects.
  • domain assumption The bandwidth limit is set by the lumped capacitance of the electrode.
    The 39 GHz projection for 22 µm pixels is based on reducing electrode area. No scaling derivation is given, and series resistance, contact resistance, and parasitic capacitance are not quantified.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Highly efficient, tunable, electro-optic metasurfaces based on quasi-bound states in the continuum." pith.science (2026). https://pith.science/paper/L4PQ5DY2

@misc{pith2026241201449,
  author       = {Pith},
  title        = {Pith review of: Highly efficient, tunable, electro-optic metasurfaces based on quasi-bound states in the continuum},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/L4PQ5DY2}},
  note         = {Machine review of arXiv:2412.01449}
}
abstract

Ultrafast and highly efficient dynamic optical metasurfaces enabling truly spatiotemporal control over optical radiation are poised to revolutionize modern optics and photonics, but their practical realization remains elusive. In this work, we demonstrate highly efficient electro-optic metasurfaces based on quasi-bound states in the continuum (qBIC) operating in reflection that are amenable for ultrafast operation and thereby spatiotemporal control over reflected optical fields. The material configuration consists of a lithium niobate thin film sandwiched between an optically thick gold back-reflector and a grating of gold nanoridges also functioning as control electrodes. Metasurfaces for optical free-space intensity modulation are designed by utilizing the electro-optic Pockels effect in combination with an ultra-narrow qBIC resonance, whose wavelength can be finely tuned by varying the angle of light incidence. The fabricated electro-optic metasurfaces operate at telecom wavelengths with the modulation depth reaching 95 % (modulating thereby 35 % of the total incident power) for a bias voltage of +/-30 V within the electrical bandwidth of 125 MHz. Leveraging the highly angle-dependent qBIC resonance realized, we demonstrate electrically tunable phase contrast imaging using the fabricated metasurface. Moreover, given the potential bandwidth of 39 GHz estimated for the metasurface pixel size of 22 $\mu$m, the demonstrated electro-optic metasurfaces promise successful realization of unique optical functions, such as harmonic beam steering and spatiotemporal shaping as well as nonreciprocal operation.

Figures

Figures reproduced from arXiv: 2412.01449 by the authors.

Figure 1
Figure 1. 3D rendering of our tunable qBIC metasurface with an incident continuous beam and a modulated outgoing beam. Top plots show the experimentally applied electrical square-shaped signal (left plot) and the corresponding measured modulated optical output (right plot). dynamic optical components [34]. The main challenge faced when implementing electro-optic meta￾surfaces is that very small refractive index changes due to… view at source ↗
Figure 2
Figure 2. Investigation of modes in the geometry and calculation of Q factor. a-d are for the symmetric grating, and e-h are for the asymmetric grating. a,e Schematic drawing of a metasurface consisting of a a symmetric and e asymmetric gold grating on top of 880 nm of LN on a gold substrate. b,f Simulated dispersion curves. c,g Simulated Q factor vs. c ridge width (lower axis, blue curve) and ridge thickness (upper axis, red… view at source ↗
Figure 3
Figure 3. Simulated performance of tunable qBIC metasurface. a-c represent simulations for the symmetric grating, and d-f represent simulations for the asymmetric grating. a,d Reflectance (left axis, black line) and absolute modulation (right axis, red dashed line) vs. wavelength for bias voltages of 0 V and ±30 V, respectively. b,e Zoomed in view of reflectance vs. wavelength for bias voltages of -30 V (blue line), 0 V (blac… view at source ↗
Figures from the paper (2 more)
Figure 4
Figure 4. Figure 4: Fabrication and static characterization of qBIC metasurface. a Optical images of a macroscopic electrode and metasurface. b SEM images of the entire grating (N = 120) and a zoom-in view of the fabricated gold ridges. Scale bars represent 10 µm (left) and 1 µm (right). …
Figure 5
Figure 5. Figure 5: Dynamic characterization of the fabricated tunable qBIC metasurface. a Measured reflection intensity (left axis, black dots and line) and absolute modulation (right axis, red dots and line) vs. wavelength for bias voltages of 0 V and ±30 V, respectively. Measurements a…

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Ultra-BroadBand Electromagnetic Control Using a Triple Circular Ring Metasurface: Surface Wave Propagation, Beam Steering, and RCS reduction (50-100 Ghz)

    physics.optics 2026-05 unverdicted novelty 4.0 of 10

    A triple-ring FR-4 metasurface is simulated to claim −30 to −40 dB monostatic RCS reduction, beam steering, and surface-wave guiding across 50–100 GHz, but the reported reflection amplitude and phase are those of a un...

Reference graph

Works this paper leans on

49 extracted references · 49 canonical work pages · cited by 1 Pith paper

  1. [1]

    Pockels modulation in integrated nanophotonics,

    M. Thomaschewski and S. I. Bozhevolnyi, “Pockels modulation in integrated nanophotonics,” Applied Physics Reviews, vol. 9, p. 021311, June 2022

    work page 2022

  2. [2]

    Electro-optic modulation in integrated photonics,

    G. Sinatkas, T. Christopoulos, O. Tsilipakos, and E. E. Kriezis, “Electro-optic modulation in integrated photonics,”Journal of Applied Physics, vol. 130, p. 010901, July 2021

    work page 2021

  3. [3]

    Designforquality: reconfigurable flat optics based on active metasurfaces,

    M. Y. Shalaginov, S. D. Campbell, S. An, Y. Zhang, C. Ríos, E. B. Whiting, Y. Wu, L. Kang, B.Zheng, C.Fowler, H.Zhang, D.H.Werner, J.Hu, andT.Gu, “Designforquality: reconfigurable flat optics based on active metasurfaces,”Nanophotonics, vol. 9, pp. 3505–3534, July 2020

    work page 2020

  4. [4]

    Tunable optical metasurfaces enabled by multiple modulation mechanisms,

    Y. Che, X. Wang, Q. Song, Y. Zhu, and S. Xiao, “Tunable optical metasurfaces enabled by multiple modulation mechanisms,” Nanophotonics, vol. 9, pp. 4407–4431, Oct. 2020

    work page 2020

  5. [5]

    Programmable plasmonic phasemodulationoffree-spacewavefrontsatgigahertzrates,

    A. Smolyaninov, A. E. Amili, F. Vallini, S. Pappert, and Y. Fainman, “Programmable plasmonic phasemodulationoffree-spacewavefrontsatgigahertzrates,” Nat. Photonics, vol.13, pp.431–435, Feb. 2019

    work page 2019

  6. [6]

    Electro-optic spatial light modulator from an engineered organic layer,

    I.-C. Benea-Chelmus, M. L. Meretska, D. L. Elder, M. Tamagnone, L. R. Dalton, and F. Capasso, “Electro-optic spatial light modulator from an engineered organic layer,”Nature Communications, vol. 12, p. 5928, Oct 2021

    work page 2021

  7. [7]

    All-solid-state spatial light modulator with independent phase and amplitude control for three-dimensional LiDAR applications,

    J. Park, B. G. Jeong, S. I. Kim, D. Lee, J. Kim, C. Shin, C. B. Lee, T. Otsuka, J. Kyoung, S. Kim, K.-Y. Yang, Y.-Y. Park, J. Lee, I. Hwang, J. Jang, S. H. Song, M. L. Brongersma, K. Ha, S.-W. Hwang, H. Choo, and B. L. Choi, “All-solid-state spatial light modulator with independent phase and amplitude control for three-dimensional LiDAR applications,”Natu...

    work page 2020

  8. [8]

    Mapping the world in 3d,

    B. Schwarz, “Mapping the world in 3d,”Nat. Photonics, vol. 4, pp. 429–430, July 2010. 9

    work page 2010

Show all 49 references
  1. [9]

    2-d MEMS scanner for handheld multispectral dual-axis confocal microscopes,

    I. W. Jung, D. Lopez, Z. Qiu, and W. Piyawattanametha, “2-d MEMS scanner for handheld multispectral dual-axis confocal microscopes,” J. Microelectromech. Syst., vol. 27, pp. 605–612, Aug. 2018

    2018

  2. [10]

    Full- colour 3d holographic augmented-reality displays with metasurface waveguides,

    M. Gopakumar, G.-Y. Lee, S. Choi, B. Chao, Y. Peng, J. Kim, and G. Wetzstein, “Full- colour 3d holographic augmented-reality displays with metasurface waveguides,”Nature, vol. 629, p. 791–797, May 2024

    2024

  3. [11]

    Creating the ultimate virtual reality display,

    W.-J. Joo and M. L. Brongersma, “Creating the ultimate virtual reality display,”Science, vol. 377, no. 6613, pp. 1376–1378, 2022

    2022

  4. [12]

    Adaptive metalenses with simulta- neous electrical control of focal length, astigmatism, and shift,

    A. She, S. Zhang, S. Shian, D. R. Clarke, and F. Capasso, “Adaptive metalenses with simulta- neous electrical control of focal length, astigmatism, and shift,”Science Advances, vol. 4, no. 2, p. eaap9957, 2018

    2018

  5. [13]

    Stretchable binary fresnel lens for focus tuning,

    X. Li, L. Wei, R. H. Poelma, S. Vollebregt, J. Wei, H. P. Urbach, P. M. Sarro, and G. Q. Zhang, “Stretchable binary fresnel lens for focus tuning,”Scientific Reports, vol. 6, p. 25348, May 2016

    2016

  6. [14]

    Electrical tuning of phase-change antennas and metasurfaces,

    Y. Wang, P. Landreman, D. Schoen, K. Okabe, A. Marshall, U. Celano, H.-S. P. Wong, J. Park, and M. L. Brongersma, “Electrical tuning of phase-change antennas and metasurfaces,”Nature Nanotechnology, vol. 16, pp. 667–672, Apr. 2021

    2021

  7. [15]

    Electrically reconfigurable non-volatile metasurface using low-loss optical phase-change material,

    Y. Zhang, C. Fowler, J. Liang, B. Azhar, M. Y. Shalaginov, S. Deckoff-Jones, S. An, J. B. Chou, C. M. Roberts, V. Liberman, M. Kang, C. Ríos, K. A. Richardson, C. Rivero-Baleine, T. Gu, H. Zhang, and J. Hu, “Electrically reconfigurable non-volatile metasurface using low-loss o...

    2021

  8. [16]

    Electrically driven reprogrammable phase-change metasurface reaching 80% efficiency,

    S. Abdollahramezani, O. Hemmatyar, M. Taghinejad, H. Taghinejad, A. Krasnok, A. A. Eftekhar, C. Teichrib, S. Deshmukh, M. A. El-Sayed, E. Pop, M. Wuttig, A. Alù, W. Cai, and A. Adibi, “Electrically driven reprogrammable phase-change metasurface reaching 80% efficiency,”Nature ...

    2022

  9. [17]

    Metasurfaces for enhancing light absorption in thermoelectric photodetectors,

    N. Sharma, J. Bar-David, N. Mazurski, and U. Levy, “Metasurfaces for enhancing light absorption in thermoelectric photodetectors,”ACS Photonics, vol. 7, pp. 2468–2473, July 2020

    2020

  10. [18]

    Reversible thermal tuning of all-dielectric metasurfaces,

    M. Rahmani, L. Xu, A. E. Miroshnichenko, A. Komar, R. Camacho-Morales, H. Chen, Y. Zárate, S. Kruk, G. Zhang, D. N. Neshev, and Y. S. Kivshar, “Reversible thermal tuning of all-dielectric metasurfaces,” Advanced Functional Materials, vol. 27, p. 1700580, July 2017

    2017

  11. [19]

    Dynamic piezoelectric mems-based optical metasurfaces,

    C. Meng, P. C. V. Thrane, F. Ding, J. Gjessing, M. Thomaschewski, C. Wu, C. Dirdal, and S. I. Bozhevolnyi, “Dynamic piezoelectric mems-based optical metasurfaces,”Science Advances, vol. 7, no. 26, p. eabg5639, 2021

    2021

  12. [20]

    Full-range birefringence control with piezoelectric mems-based metasurfaces,

    C. Meng, P. C. V. Thrane, F. Ding, and S. I. Bozhevolnyi, “Full-range birefringence control with piezoelectric mems-based metasurfaces,”Nature Communications, vol. 13, p. 2071, Apr 2022

    2022

  13. [21]

    Mems-tunable dielectric metasurface lens,

    E. Arbabi, A. Arbabi, S. M. Kamali, Y. Horie, M. Faraji-Dana, and A. Faraon, “Mems-tunable dielectric metasurface lens,”Nature Communications, vol. 9, p. 812, Feb 2018

    2018

  14. [22]

    Electro-optically tunable multi- functional metasurfaces,

    G. K. Shirmanesh, R. Sokhoyan, P. C. Wu, and H. A. Atwater, “Electro-optically tunable multi- functional metasurfaces,” ACS Nano, vol. 14, pp. 6912–6920, Apr. 2020

    2020

  15. [23]

    Electrically tunable epsilon-near-zero (enz) metafilm absorbers,

    J. Park, J.-H. Kang, X. Liu, and M. L. Brongersma, “Electrically tunable epsilon-near-zero (enz) metafilm absorbers,” Scientific Reports, vol. 5, Nov. 2015

    2015

  16. [24]

    Electrically tunable space–time metasurfaces at optical frequencies,

    J. Sisler, P. Thureja, M. Y. Grajower, R. Sokhoyan, I. Huang, and H. A. Atwater, “Electrically tunable space–time metasurfaces at optical frequencies,”Nature Nanotechnology, July 2024. 10

    2024

  17. [25]

    Gigahertz free-space electro-optic modulators based on mie resonances,

    I.-C. Benea-Chelmus, S. Mason, M. L. Meretska, D. L. Elder, D. Kazakov, A. Shams-Ansari, L. R. Dalton, and F. Capasso, “Gigahertz free-space electro-optic modulators based on mie resonances,” Nature Communications, vol. 13, p. 3170, June 2022

    2022

  18. [26]

    High-speedmetasurfacemodulatorusingperfectlyabsorptivebimodalplasmonicresonance,

    J.Zhang, Y.Kosugi, M.Ogasawara, K.Ariu, A.Otomo, T.Yamada, Y.Nakano, andT.Tanemura, “High-speedmetasurfacemodulatorusingperfectlyabsorptivebimodalplasmonicresonance,” APL Photonics, vol. 8, Dec. 2023

    2023

  19. [27]

    Nanophotonic pockels modulators on a silicon nitride platform,

    K. Alexander, J. P. George, J. Verbist, K. Neyts, B. Kuyken, D. Van Thourhout, and J. Beeckman, “Nanophotonic pockels modulators on a silicon nitride platform,”Nature Communications, vol. 9, p. 3444, Aug 2018

    2018

  20. [28]

    Plasmonic electro-optic modulators on lead zirconate titanate platform,

    T. Yezekyan, M. Thomaschewski, P. C. V. Thrane, and S. I. Bozhevolnyi, “Plasmonic electro-optic modulators on lead zirconate titanate platform,”Nanophotonics, vol. 0, Mar. 2024

    2024

  21. [29]

    Plasmonic monolithic lithium niobate directional coupler switches,

    M. Thomaschewski, V. A. Zenin, C. Wolff, and S. I. Bozhevolnyi, “Plasmonic monolithic lithium niobate directional coupler switches,”Nat. Commun., vol. 11, p. 748, Feb 2020

    2020

  22. [30]

    Lithium niobate thin film electro-optic modulator,

    J. Liu, L. Qu, W. Wu, C. Jin, Z. Chen, Z. Gu, W. Liu, C. Wang, D. Zheng, H. Liu, W. Cai, M. Ren, and J. Xu, “Lithium niobate thin film electro-optic modulator,”Nanophotonics, vol. 13, p. 1503–1508, Feb. 2024

    2024

  23. [31]

    Electro-optic metasurface- based free-space modulators,

    C. Damgaard-Carstensen, M. Thomaschewski, and S. I. Bozhevolnyi, “Electro-optic metasurface- based free-space modulators,”Nanoscale, vol. 14, no. 31, pp. 11407–11414, 2022

    2022

  24. [32]

    Material tensor parameters of LiNbO3 relevant for electro- and elasto-optics,

    M. Jazbinšek and M. Zgonik, “Material tensor parameters of LiNbO3 relevant for electro- and elasto-optics,” Appl. Phys. B: Lasers Opt., vol. 74, pp. 407–414, Apr. 2002

    2002

  25. [33]

    Lithium niobate: Summary of physical properties and crystal structure,

    R. S. Weis and T. K. Gaylord, “Lithium niobate: Summary of physical properties and crystal structure,” Appl. Phys. A: Solids Surf., vol. 37, pp. 191–203, Aug. 1985

    1985

  26. [34]

    Integrated lithium niobate electro-optic modulators: when performance meets scalability,

    M. Zhang, C. Wang, P. Kharel, D. Zhu, and M. Lončar, “Integrated lithium niobate electro-optic modulators: when performance meets scalability,”Optica, vol. 8, p. 652, May 2021

    2021

  27. [35]

    Electro-optic lithium niobate metasurfaces,

    B. Gao, M. Ren, W. Wu, W. Cai, and J. Xu, “Electro-optic lithium niobate metasurfaces,”Sci. China: Phys., Mech. Astron., vol. 64, p. 240362, Feb 2021

    2021

  28. [36]

    Enhanced electro-optic modulation in resonant metasurfaces of lithium niobate,

    H. Weigand, V. V. Vogler-Neuling, M. R. Escalé, D. Pohl, F. U. Richter, A. Karvounis, F. Timpu, and R. Grange, “Enhanced electro-optic modulation in resonant metasurfaces of lithium niobate,” ACS Photonics, vol. 8, pp. 3004–3009, Sept. 2021

    2021

  29. [37]

    Electrical tuning of fresnel lens in reflection,

    C. Damgaard-Carstensen, M. Thomaschewski, F. Ding, and S. I. Bozhevolnyi, “Electrical tuning of fresnel lens in reflection,”ACS Photonics, vol. 8, pp. 1576–1581, June 2021

    2021

  30. [38]

    Nonlocal electro-optic metasurfaces for free-space light modulation,

    C. Damgaard-Carstensen and S. I. Bozhevolnyi, “Nonlocal electro-optic metasurfaces for free-space light modulation,” Nanophotonics, vol. 12, p. 2953–2962, Apr. 2023

    2023

  31. [39]

    Engineering quasi-bound states in the continuum in asymmetric waveguide gratings,

    T. Yezekyan, S. Boroviks, O. J. F. Martin, and S. I. Bozhevolnyi, “Engineering quasi-bound states in the continuum in asymmetric waveguide gratings,”New Journal of Physics, vol. 26, p. 093027, Sept. 2024

    2024

  32. [40]

    Passive bias-free non-reciprocal metasurfaces based on thermally nonlinear quasi-bound states in the continuum,

    M. Cotrufo, A. Cordaro, D. L. Sounas, A. Polman, and A. Alù, “Passive bias-free non-reciprocal metasurfaces based on thermally nonlinear quasi-bound states in the continuum,”Nature Photon- ics, vol. 18, pp. 81–90, Jan 2024

    2024

  33. [41]

    Ultrahigh-q guided mode resonances in an all-dielectric metasurface,

    L. Huang, R. Jin, C. Zhou, G. Li, L. Xu, A. Overvig, F. Deng, X. Chen, W. Lu, A. Alù, and A. E. Miroshnichenko, “Ultrahigh-q guided mode resonances in an all-dielectric metasurface,”Nature Communications, vol. 14, June 2023. 11

    2023

  34. [42]

    Formation of bound states in the continuum in hybrid plasmonic-photonic systems,

    S. I. Azzam, V. M. Shalaev, A. Boltasseva, and A. V. Kildishev, “Formation of bound states in the continuum in hybrid plasmonic-photonic systems,”Physical Review Letters, vol. 121, Dec. 2018

    2018

  35. [43]

    Large-area wide-angle spectrally selective plasmonic absorber,

    C. Wu, B. Neuner, G. Shvets, J. John, A. Milder, B. Zollars, and S. Savoy, “Large-area wide-angle spectrally selective plasmonic absorber,”Physical Review B, vol. 84, p. 075102, Aug. 2011

    2011

  36. [44]

    Spatiotemporal light control with active metasurfaces,

    A. M. Shaltout, V. M. Shalaev, and M. L. Brongersma, “Spatiotemporal light control with active metasurfaces,” Science, vol. 364, no. 6441, p. eaat3100, 2019

    2019

  37. [45]

    Tunable metasurface using thin-film lithium niobate in the telecom regime,

    A. Weiss, C. Frydendahl, J. Bar-David, R. Zektzer, E. Edrei, J. Engelberg, N. Mazurski, B. Desi- atov, and U. Levy, “Tunable metasurface using thin-film lithium niobate in the telecom regime,” ACS Photonics, vol. 9, pp. 605–612, Jan. 2022

    2022

  38. [46]

    Quantitative phase contrast imaging with a nonlocal angle-selective metasurface,

    A. Ji, J.-H. Song, Q. Li, F. Xu, C.-T. Tsai, R. C. Tiberio, B. Cui, P. Lalanne, P. G. Kik, D. A. B. Miller, and M. L. Brongersma, “Quantitative phase contrast imaging with a nonlocal angle-selective metasurface,”Nature Communications, vol. 13, Dec. 2022

    2022

  39. [47]

    Optical constants of transition metals: Ti, v, cr, mn, fe, co, ni, and pd,

    P. Johnson and R. Christy, “Optical constants of transition metals: Ti, v, cr, mn, fe, co, ni, and pd,” Phys. Rev. B, vol. 9, pp. 5056–5070, June 1974

    1974

  40. [48]

    Infrared corrected sellmeier coefficients for congruently grown lithium niobate and 5 mol% magnesium oxide –doped lithium niobate,

    D. E. Zelmon, D. L. Small, and D. Jundt, “Infrared corrected sellmeier coefficients for congruently grown lithium niobate and 5 mol% magnesium oxide –doped lithium niobate,”J. Opt. Soc. Am. B, vol. 14, p. 3319, Dec. 1997

    1997

  41. [49]

    Optical properties of metallic films for vertical-cavity optoelectronic devices,

    A. D. Rakić, A. B. Djurišić, J. M. Elazar, and M. L. Majewski, “Optical properties of metallic films for vertical-cavity optoelectronic devices,”Appl. Opt., vol. 37, pp. 5271–5283, Aug 1998. 12

    1998

Pith tools

Reviewed August 12, 2026 · model on record in the stance chip above.