Pith. sign in

REVIEW 3 major objections 3 minor 76 references

Learning by Confusion: The Phase Diagram of the Holstein Model

T0 review · 3 major / 3 minor · reviewed 2026-08-10 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read The paper claims that learning-by-confusion applied to determinant quantum Monte Carlo snapshots of the half-filled two-dimensional Holstein model locates the charge-density-wave transition temperature and a high-temperature crossover to…

desk verdict A solid, honest first application of learning by confusion to the Holstein model that confirms known CDW physics and suggests a crossover, but the large-coupling phase boundary rests on unvalidated peak picking. read the letter →

arxiv 2501.04681 v5 pith:ZZPJXHRT submitted 2025-01-08 cond-mat.str-el cond-mat.dis-nn

George Issa , Owen Bradley , Ehsan Khatami , Richard Scalettar This is my paper · ORCID
classification cond-mat.str-elcond-mat.dis-nn PACS 71.30.+h71.45.Lr63.20.-e
keywords learningbyconfusionHolsteinmodelchargedensitywavedeterminantquantumMonteCarlophasediagrammachineconvolutionalneuralnetworkbipolaroncrossover
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper claims that the learning-by-confusion (LBC) method, a supervised binary classification scheme with deliberately mislabeled data, can extract the finite-temperature phase diagram of the half-filled two-dimensional Holstein model from raw determinant quantum Monte Carlo snapshots. Using a convolutional neural network trained on electron-density or phonon-position images, the interior peak of the W-shaped test-accuracy curve locates the charge-density-wave (CDW) transition temperature, and horizontal coupling sweeps above the CDW dome locate a crossover to a random gas of empty and doubly occupied sites. If correct, this gives an order-parameter-free route to phase boundaries for electron-phonon models, bypassing structure-factor finite-size scaling.

What carries the argument

The load-bearing tool is the learning-by-confusion protocol applied to a convolutional neural network: for a sweep of a control parameter ($\beta$ or $\lambda_D$), each snapshot is labeled 0 or 1 according to a guessed critical value; the test accuracy as a function of the guess produces a W shape whose central peak is read off as the transition or crossover location. The snapshots are generated by determinant quantum Monte Carlo with hybrid Monte Carlo updates, using either electron-density fields, phonon-position fields, or space- and momentum-resolved density-density correlations as input images.

What would settle it

Locate the CDW transition for $\lambda_D=0.775$ on larger lattices ($L=12$, $16$, $20$) using conventional structure-factor finite-size scaling; if the true $T_c$ is near 0.17 as the shoulder in Fig. A1 suggests, the LBC interior-peak position at $\beta\approx5.8$ is a finite-size artifact and the method needs a size-extrapolation prescription.

Watch

Extended reading notes

Core claim

The central claim is that the W-shaped accuracy curve of LBC contains two physically meaningful features: the interior maximum marks the CDW critical inverse temperature $\beta_c$, and a similar maximum in $\lambda_D$ sweeps at fixed temperature marks a crossover from a disordered Fermi gas to a bipolaron gas before CDW order sets in. The authors demonstrate this for the Holstein model on square lattices ($L=8$ and $L=12$) with $\omega_0=1.0$, obtaining $\beta_c$ values consistent with prior structure-factor and finite-size-scaling studies for $0.250 \leq \lambda_D \lesssim 0.600$, and they use the two features to build the $T$-$\lambda_D$ phase diagram of Fig. 4. They also find that raw electron-density snapshots work best for $\beta$ sweeps while phonon-position snapshots give cleaner signals for $\lambda_D$ sweeps, and that equal-time snapshots suffice.

Load-bearing premise

The interior peak of the LBC accuracy curve marks the true transition or crossover even when the confusion signal is weak, with minima as high as 0.93 accuracy and no controlled finite-size scaling for most of the phase diagram.

Editorial extensions

If this is right

  • LBC yields $\beta_c$ values for the Holstein CDW transition that agree with conventional structure-factor finite-size scaling in the coupling range studied, suggesting the method can serve as a quicker phase-boundary estimator.
  • The method detects a crossover to a gas of empty and doubly occupied sites that the authors connect to the local-moment structure of the repulsive Hubbard model and its attractive counterpart, extending LBC beyond true phase transitions.
  • Equal-time spatial snapshots of raw densities produce clearer W curves than correlation-function inputs, so no pre-averaged order parameter is needed.
  • The approach works in the adiabatic limit $\omega_0 \to 0$ (demonstrated at $\omega_0=0.1$), where conventional finite-size scaling is notoriously difficult.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • A quantitative use of LBC will require establishing how the interior-peak position scales with lattice size; the anomalous $\lambda_D=0.775$ point suggests that without such scaling, split or shoulder peaks can shift the inferred $T_c$.
  • The same snapshot-based protocol could be applied to the doped Holstein or Holstein-Hubbard models to map superconducting and competing orders without prescribing an order parameter, provided the fermion sign problem can be managed.
  • Because the W minima sit as high as 0.93 accuracy, the reliability of a detected peak may depend on network capacity and training epochs; a systematic study of peak depth versus these resources would show when a W feature is physically meaningful.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 3 minor

Summary. The paper applies the unsupervised "learning by confusion" (LBC) method to determinant quantum Monte Carlo snapshots of the half-filled two-dimensional Holstein model, using a convolutional neural network to perform binary classification tasks with guessed transition locations. The authors study several data representations (electron density snapshots, phonon position snapshots, and real- and momentum-space density-density correlations) and extract the CDW transition temperature from the interior peak of the W-shaped accuracy curve in inverse-temperature sweeps at ten values of the electron-phonon coupling, and a high-temperature crossover to a gas of empty and doubly occupied sites from coupling sweeps at fixed temperature. The resulting T-lambda_D phase diagram is compared to prior DQMC results for moderate coupling, with particular attention to two validated points (lambda_D = 0.250 and 0.325) and to one admitted anomalous point at lambda_D = 0.775.

Significance. If the LBC extraction is reliable, the paper demonstrates a direct, order-parameter-free route from raw Monte Carlo configurations to phase boundaries for an electron-phonon model, which is valuable because the Holstein model has both fermionic and bosonic degrees of freedom and the method can identify which representation best encodes ordering. The paper provides a useful systematic comparison of electron-density, phonon-position, and correlation-function inputs, and it explicitly checks two LBC peaks against finite-size scaled structure-factor crossings. The construction of a crossover boundary in a regime where no true phase transition exists is a plausible and physically interesting extension of LBC, though it is harder to validate. The main limitation, acknowledged in the text, is that most phase diagram points lack finite-size scaling and that the confusion signal can be shallow, so the central methodological claim requires additional validation before the quantitative phase diagram can be fully trusted.

major comments (3)
  1. [§III, Fig. A1 and Fig. 4] The CDW branch of Fig. 4 for lambda_D = 0.400 through 0.925 is read from L = 8 LBC accuracy curves in Fig. A1 without any finite-size scaling, whereas only lambda_D = 0.250 and 0.325 are checked against structure-factor crossings in Fig. 2(b). The admitted anomaly at lambda_D = 0.775, where the selected interior peak overestimates T_c and the presumed true transition appears only as a shoulder near beta ~ 5.8, demonstrates concretely that the LBC identification can select the wrong feature on an L = 8 sweep. Since the anomaly is attributed to finite-size effects, the same mechanism could bias other large-coupling points, so the phase diagram beyond the two validated couplings is not secured. I request finite-size scaling of the LBC peak position, or independent order-parameter crossings, for at least several additional lambda_D values, especially in the range lambda_D > 0.5.
  2. [§IV, final paragraph] The paper notes that in several W curves the lowest accuracy is as high as 0.93, meaning the interior minimum lies only about 0.07 below the trivial accuracy of 1.0. With only ten random seeds and no quantitative measure of peak width or of the separation between the interior peak and adjacent minima, the error bars in Fig. 4 (standard errors over seeds) do not capture the systematic risk of misreading a shallow feature, as happened at lambda_D = 0.775. The authors should provide a criterion for when a W curve is considered unambiguous, or report the peak-finding procedure (e.g., smoothing, peak-width estimates, and how the lambda_D = 0.775 shoulder was rejected) so that the remaining points can be evaluated.
  3. [§III, Fig. 5(e)-(f) and Fig. A2] The crossover boundary (green crosses in Fig. 4) is obtained from the interior maxima of LBC lambda_D sweeps using phonon snapshots, but unlike the CDW boundary there is no independent observable that confirms the LBC peak marks the physical crossover rather than a finite-size artifact. The paper itself attributes subsidiary structure in the lambda_D sweeps to discrete Brillouin-zone filling effects (Sec. III), so the reader cannot distinguish the crossover signal from such artifacts. A direct comparison of the LBC peak position with, for example, the onset of the large-lambda_D rise in S(pi,pi) in Fig. A2, or with the occupancy statistics (n_i = 0 vs. 2), would make the crossover identification load-bearing evidence rather than an interpretation of the same LBC peaks that define it.
minor comments (3)
  1. [Fig. A3 caption] The caption of Fig. A3 states that both temperatures lie below the CDW dome, while the main text and the caption of Fig. 5 state that beta = 3.50 and beta = 3.25 are above the CDW dome; this inconsistency should be corrected.
  2. [Fig. 5(d) caption] The caption contains a typo, "correspdonds" should be "corresponds".
  3. [§III, text near Fig. 2(a)] The phrase "one under-estimated value for S(pi, pi)" is awkward; "underestimated" is the standard term, and it would help to state whether the point is excluded from the analysis or merely flagged.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: the LBC phase boundaries are benchmarked against independent finite-size scaling of the CDW structure factor and against prior DQMC results; the admitted anomaly and the crossover line are robustness or interpretation caveats, not constructional reductions.

full rationale

The central claim is that the interior peak of the LBC accuracy curve marks the CDW transition and a high-temperature crossover. This is an output of the method, not a parameter fitted to the target phase boundary. The paper provides an independent check for two representative couplings: the structure-factor crossings in Fig. 2(b), obtained from the standard scaling S(pi,pi)L^{-7/4} with the known Ising exponent, agree with the LBC W-peak positions. That comparison breaks any reduction of the CDW boundary to the LBC definition itself. For other couplings, the authors compare with prior DQMC studies; although one cited work (ref. 47) includes a present author, the agreement is corroborated by the independent work of ref. 45 and by the in-paper finite-size scaling at the two anchor points, so the self-citation is not load-bearing. The admitted anomalous point at lambda_D=0.775 is explicitly presented as a limitation of error estimation in LBC and attributed to finite-size effects; this is a correctness caveat, not a circular step, because the authors do not use the anomaly as evidence that the method is equivalent to its input. The crossover line is more weakly anchored: it is read from the same LBC accuracy peaks that operationally define it, and the paper concedes that LBC alone cannot distinguish a transition from a crossover. However, the physical association with a gas of empty and doubly occupied sites is supported by direct snapshots and by the structure-factor behavior in Fig. A2, and the paper does not claim to derive a pre-existing quantitative crossover temperature from first principles. At most this is an interpretational or robustness concern. No equation in the paper sets the LBC peak equal to a target quantity by construction, and no fitted parameter is renamed as a prediction. The shallow W minima and the lack of finite-size scaling for most points affect precision and reliability, but they do not make the derivation circular.

Assumptions & free parameters 6 free parameters · 5 assumptions · 0 invented entities

No new particles, forces, or conserved quantities are introduced. The central result depends on the methodological assumption that LBC W peaks locate transitions/crossovers, on the DQMC sampling being correct, and on L=8 representing the thermodynamic limit. The free parameters are mostly network and data-sweep choices; none are fitted physical constants, but they affect the inferred peak positions.

free parameters (6)
  • CNN architecture (16 3x3 filters, 2 dense layers of 256 nodes)
    Network capacity is fixed without reported systematic tuning; the paper notes in Sec. IV that the W minima rely on limited resources, so capacity affects the method's output.
  • Number of epochs / training duration = unspecified
    The text mentions epochs only qualitatively ('given enough time (epochs) and fitting parameters'), so the stopping point is an unreported hand-chosen parameter.
  • Np, number of beta or lambda_D values in a sweep = 25-50
    Authors state this parameter was adjusted across simulations to balance resolution and training cost (Sec. II C).
  • ns, sweeps between saved snapshots = 20, 50, 100
    Controls the number of training snapshots; robustness to ns is checked, but the choice is a methodological free parameter.
  • nit, imaginary-time slices for correlation datasets = 3-5
    Used to build density-density correlation snapshots; varied to test robustness.
  • Sweep endpoints (beta_min=1, beta_max=12; lambda ranges)
    The chosen window bounds the detectable transition/crossover region and therefore influences the position of the W peak.
assumptions (5)
  • domain assumption The interior peak of the LBC accuracy W shape marks the true phase transition or crossover location.
    Core inference of the method, introduced in Sec. II C; the paper explicitly acknowledges in Sec. IV that LBC does not rigorously distinguish transitions from crossovers.
  • domain assumption Determinant quantum Monte Carlo with hybrid Monte Carlo updates samples the Holstein model without bias.
    Relied on in Sec. II B to generate snapshots; sign-problem-free because the two spin determinants are identical.
  • domain assumption Lattice size L=8 is representative for the phase diagram.
    Most points in Fig. 4 come from L=8 without finite-size scaling; the paper notes finite-size effects are visible in noisy lambda sweeps and in the λD=0.775 anomaly.
  • standard math The CDW transition is in the Ising universality class, so S(pi,pi) L^(-7/4) curves cross at beta_c.
    Used in Sec. III and Fig. 2 for the conventional finite-size scaling check against LBC.
  • domain assumption The high-temperature feature detected by LBC in lambda sweeps corresponds to the formation of a bipolaron gas.
    Interpreted in Sec. III from electron density and phonon snapshots plus S(pi,pi); no independent thermodynamic observable or scaling analysis is used to define the crossover.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Learning by Confusion: The Phase Diagram of the Holstein Model." pith.science (2026). https://pith.science/paper/ZZPJXHRT

@misc{pith2026250104681,
  author       = {Pith},
  title        = {Pith review of: Learning by Confusion: The Phase Diagram of the Holstein Model},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/ZZPJXHRT}},
  note         = {Machine review of arXiv:2501.04681}
}
read the original abstract

We employ the "learning by confusion" technique, an unsupervised machine learning approach for detecting phase transitions, to analyze quantum Monte Carlo simulations of the two-dimensional Holstein model--a fundamental model for electron-phonon interactions on a lattice. Utilizing a convolutional neural network, we conduct a series of binary classification tasks to identify Holstein critical points based on the neural network's learning accuracy. We further evaluate the effectiveness of various training datasets, including snapshots of phonon fields and other measurements resolved in imaginary time, for predicting distinct phase transitions and crossovers. Our results culminate in the construction of the finite-temperature phase diagram of the Holstein model.

Figures

Figures reproduced from arXiv: 2501.04681 by the authors.

Figure 1
Figure 1. FIG. 1: (a) [PITH_FULL_IMAGE:figures/full_fig_p003_1.png] view at source ↗
Figure 2
Figure 2. (a), with βc roughly estimated as the place where S(π, π) grows most rapidly. A more precise determina￾tion of βc is obtained by scaling S(π, π) using the known Ising universality class of the CDW transition, for which γ/ν = 7/4. Curves for different L cross at βc [ [PITH_FULL_IMAGE:figures/full_fig_p004_2.png] view at source ↗
Figure 4
Figure 4. FIG. 4 [PITH_FULL_IMAGE:figures/full_fig_p005_4.png] view at source ↗
Figures from the paper (2 more)
Figure 3
Figure 3. Figure 3: further explores the dependence of the LBC results on the number of training electron density and phonon position data sets; ns = 20 having five times the number of snapshots as ns = 100. Although the shape of the W away from the interior maximum varies, we ∏D T ! =1.0…
Figure 5
Figure 5. Figure 5: FIG. 5 [PITH_FULL_IMAGE:figures/full_fig_p006_5.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

76 extracted references · 51 canonical work pages

  1. [1]

    author author Lei \ Wang ,\ title title Discovering phase transitions with unsupervised learning , \ https://journals.aps.org/prb/pdf/10.1103/PhysRevB.94.195105 journal journal Physical Review B \ volume 94 ,\ pages 195105 ( year 2016 ) NoStop

    doi:10.1103/physrevb.94.195105

  2. [2]

    author author Juan \ Carrasquilla \ and\ author Roger G \ Melko ,\ title title Machine learning phases of matter , \ https://www.nature.com/articles/nphys4035.pdf journal journal Nature Physics \ volume 13 ,\ pages 431 ( year 2017 ) NoStop

    work page 2017

  3. [3]

    author author Wenjian \ Hu , author Rajiv RP \ Singh , \ and\ author Richard T \ Scalettar ,\ title title Discovering phases, phase transitions, and crossovers through unsupervised machine learning: A critical examination , \ https://journals.aps.org/pre/pdf/10.1103/PhysRevE.95.062122 journal journal Physical Review E \ volume 95 ,\ pages 062122 ( year 20...

    doi:10.1103/physreve.95.062122

  4. [5]

    author author Giuseppe \ Carleo \ and\ author Matthias \ Troyer ,\ title title Solving the quantum many-body problem with artificial neural networks , \ https://www.science.org/doi/pdf/10.1126/science.aag2302 journal journal Science \ volume 355 ,\ pages 602--606 ( year 2017 ) NoStop

    doi:10.1126/science.aag2302

  5. [6]

    author author Yi Zhang \ and\ author Eun-Ah \ Kim ,\ title title Quantum loop topography for machine learning , \ https://journals.aps.org/prl/pdf/10.1103/PhysRevLett.118.216401 journal journal Physical review letters \ volume 118 ,\ pages 216401 ( year 2017 ) NoStop

    work page doi:10.1103/physrevlett.118.216401

  6. [7]

    author author Kelvin \ Ch'ng , author Nick \ Vazquez , \ and\ author Ehsan \ Khatami ,\ title title Unsupervised machine learning account of magnetic transitions in the H ubbard model , \ https://journals.aps.org/pre/pdf/10.1103/PhysRevE.97.013306 journal journal Physical Review E \ volume 97 ,\ pages 013306 ( year 2018 ) NoStop

    work page doi:10.1103/physreve.97.013306

  7. [8]

    author author Sebastian J \ Wetzel ,\ title title Unsupervised learning of phase transitions: From principal component analysis to variational autoencoders , \ https://journals.aps.org/pre/pdf/10.1103/PhysRevE.96.022140 journal journal Physical Review E \ volume 96 ,\ pages 022140 ( year 2017 ) NoStop

    doi:10.1103/physreve.96.022140

  8. [9]

    author author Patrick \ Huembeli , author Alexandre \ Dauphin , \ and\ author Peter \ Wittek ,\ title title Identifying quantum phase transitions with adversarial neural networks , \ https://journals.aps.org/prb/pdf/10.1103/PhysRevB.97.134109 journal journal Physical Review B \ volume 97 ,\ pages 134109 ( year 2018 ) NoStop

    work page doi:10.1103/physrevb.97.134109

Show all 76 references
  1. [10]

    author author Jordan \ Venderley , author Vedika \ Khemani , \ and\ author Eun-Ah \ Kim ,\ title title Machine learning out-of-equilibrium phases of matter , \ https://journals.aps.org/prl/pdf/10.1103/PhysRevLett.120.257204 journal journal Physical Review Letters \ volume 120 ...

    doi

  2. [12]

    author author Sheng \ Zhang , author Puhan \ Zhang , \ and\ author Gia-Wei \ Chern ,\ title title Anomalous phase separation in a correlated electron system: Machine-learning--enabled large-scale kinetic M onte C arlo simulations , \ https://pmc.ncbi.nlm.nih.gov/articles/PMC91...

    2022

  3. [13]

    \ Vergniory , \ and\ author Gregory A

    author author Martin \ Rodriguez-Vega , author Maia G. \ Vergniory , \ and\ author Gregory A. \ Fiete ,\ title title Quantum materials out of equilibrium , \ 10.1063/PT.3.5001 journal journal Physics Today \ volume 75 ,\ pages 42--47 ( year 2022 ) NoStop

    doi

  4. [14]

    author author Annabelle \ Bohrdt , author Christie S \ Chiu , author Geoffrey \ Ji , author Muqing \ Xu , author Daniel \ Greif , author Markus \ Greiner , author Eugene \ Demler , author Fabian \ Grusdt , \ and\ author Michael \ Knap ,\ title title Classifying snapshots of th...

    2019

  5. [15]

    a ming , author Matthias \ Tarnowski , author Luca \ Asteria , author Nick \ Fl \

    author author Benno S \ Rem , author Niklas \ K \"a ming , author Matthias \ Tarnowski , author Luca \ Asteria , author Nick \ Fl \"a schner , author Christoph \ Becker , author Klaus \ Sengstock , \ and\ author Christof \ Weitenberg ,\ title title Identifying quantum phase tr...

    2019

  6. [16]

    author author Yi Zhang , author A Mesaros , author Kazuhiro \ Fujita , author SD Edkins , author MH Hamidian , author K Ch’ng , author H Eisaki , author S Uchida , author JC S \'e amus \ Davis , author Ehsan \ Khatami , et al. ,\ title title Machine learning in electronic-quan...

    2019

  7. [17]

    author author Giacomo \ Torlai , author Brian \ Timar , author Evert P. L. \ van Nieuwenburg , author Harry \ Levine , author Ahmed \ Omran , author Alexander \ Keesling , author Hannes \ Bernien , author Markus \ Greiner , author Vladan \ Vuleti c \' c , author Mikhail D. \ L...

    doi

  8. [18]

    author author Ehsan \ Khatami , author Elmer \ Guardado-Sanchez , author Benjamin M \ Spar , author Juan Felipe \ Carrasquilla , author Waseem S \ Bakr , \ and\ author Richard T \ Scalettar ,\ title title Visualizing strange metallic correlations in the two-dimensional F ermi-...

    doi

  9. [19]

    author author Anjana M \ Samarakoon , author Kipton \ Barros , author Ying Wai \ Li , author Markus \ Eisenbach , author Qiang \ Zhang , author Feng \ Ye , author V Sharma , author ZL Dun , author Haidong \ Zhou , author Santiago A \ Grigera , et al. ,\ title title Machine-lea...

    2020

  10. [20]

    author author Steven \ Johnston , author Ehsan \ Khatami , \ and\ author Richard \ Scalettar ,\ title title A perspective on machine learning and data science for strongly correlated electron problems , \ https://www.sciencedirect.com/science/article/pii/S2667056922000876 jour...

    2022

  11. [21]

    author author Anna \ Dawid , author Julian \ Arnold , author Borja \ Requena , author Alexander \ Gresch , author Marcin \ P odzie \'n , author Kaelan \ Donatella , author Kim A \ Nicoli , author Paolo \ Stornati , author Rouven \ Koch , author Miriam \ B \"u ttner , et al. ,\...

    2022

  12. [22]

    author author Juan \ Carrasquilla ,\ title title Machine learning for quantum matter , \ https://www.tandfonline.com/doi/pdf/10.1080/23746149.2020.1797528 journal journal Advances in Physics: X \ volume 5 ,\ pages 1797528 ( year 2020 ) NoStop

    2020

  13. [23]

    author author Yusuke \ Nomura , author Andrew S \ Darmawan , author Youhei \ Yamaji , \ and\ author Masatoshi \ Imada ,\ title title Restricted B oltzmann machine learning for solving strongly correlated quantum systems , \ https://journals.aps.org/prb/pdf/10.1103/PhysRevB.96....

    doi

  14. [24]

    author author Peter \ Broecker , author Fakher F \ Assaad , \ and\ author Simon \ Trebst ,\ title title Quantum phase recognition via unsupervised machine learning , \ https://ar5iv.labs.arxiv.org/html/1707.00663 journal journal arXiv preprint arXiv:1707.00663 \ ( year 2017 ) NoStop

    2017 arXiv

  15. [25]

    author author Kazuya \ Shinjo , author Kakeru \ Sasaki , author Satoru \ Hase , author Shigetoshi \ Sota , author Satoshi \ Ejima , author Seiji \ Yunoki , \ and\ author Takami \ Tohyama ,\ title title Machine learning phase diagram in the half-filled one-dimensional extended ...

    doi

  16. [26]

    author author Askery \ Canabarro , author Felipe Fernandes \ Fanchini , author Andr \'e Luiz \ Malvezzi , author Rodrigo \ Pereira , \ and\ author Rafael \ Chaves ,\ title title Unveiling phase transitions with machine learning , \ https://journals.aps.org/prb/pdf/10.1103/Phys...

    doi

  17. [27]

    author author Stephanie \ Striegel , author Eduardo \ Ibarra-Garc \' a-Padilla , \ and\ author Ehsan \ Khatami ,\ title title Machine learning detection of correlations in snapshots of ultracold atoms in optical lattices , \ https://arxiv.org/abs/2310.03267 journal journal arX...

    arXiv

  18. [28]

    author author Bo Xiao , author Javier Robledo \ Moreno , author Matthew \ Fishman , author Dries \ Sels , author Ehsan \ Khatami , \ and\ author Richard \ Scalettar ,\ title title Extracting off-diagonal order from diagonal basis measurements , \ 10.1103/PhysRevResearch.6.L022...

    doi

  19. [29]

    author author Chuang \ Chen , author Xiao Yan \ Xu , author Junwei \ Liu , author George \ Batrouni , author Richard \ Scalettar , \ and\ author Zi Yang \ Meng ,\ title title Symmetry-enforced self-learning M onte C arlo method applied to the H olstein model , \ 10.1103/PhysRe...

    doi

  20. [30]

    author author Shaozhi \ Li , author Philip M \ Dee , author Ehsan \ Khatami , \ and\ author Steven \ Johnston ,\ title title Accelerating lattice quantum M onte C arlo simulations using artificial neural networks: Application to the H olstein model , \ https://journals.aps.org...

    doi

  21. [31]

    author author Yusuke \ Nomura ,\ title title Machine learning quantum states—extensions to fermion--boson coupled systems and excited-state calculations , \ https://journals.jps.jp/doi/pdf/10.7566/JPSJ.89.054706 journal journal Journal of the Physical Society of Japan \ volume...

    doi

  22. [32]

    author author Chen \ Cheng , author Sheng \ Zhang , \ and\ author Gia-Wei \ Chern ,\ title title Machine learning for phase ordering dynamics of charge density waves , \ https://journals.aps.org/prb/pdf/10.1103/PhysRevB.108.014301 journal journal Physical Review B \ volume 108...

    doi

  23. [33]

    \ Holstein ,\ title title Studies of polaron motion: Part I

    author author Th. \ Holstein ,\ title title Studies of polaron motion: Part I . the molecular-crystal model , \ https://doi.org/10.1016/0003-4916(59)90002-8 journal journal Ann. Phys. (N. Y.) \ volume 8 ,\ pages 325 ( year 1959 ) NoStop

    doi

  24. [34]

    author author Rudolf Ernst \ Peierls ,\ https://press.princeton.edu/books/paperback/9780691082424/surprises-in-theoretical-physics title Surprises in theoretical physics ,\ Vol.\ volume 107 \ ( publisher Princeton University Press ,\ year 1979 ) NoStop

    1979

  25. [35]

    author author Jorge E \ Hirsch \ and\ author Eduardo \ Fradkin ,\ title title Effect of quantum fluctuations on the P eierls instability: a M onte C arlo study , \ https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.49.402 journal journal Physical Review Letters \ volume...

    doi

  26. [36]

    author author Jorge E \ Hirsch \ and\ author Eduardo \ Fradkin ,\ title title Phase diagram of one-dimensional electron-phonon systems. ii. the molecular-crystal model , \ https://journals.aps.org/prb/abstract/10.1103/PhysRevB.27.4302 journal journal Physical Review B \ volume...

    doi

  27. [37]

    author author R. T. \ Scalettar , author N. E. \ Bickers , \ and\ author D. J. \ Scalapino ,\ title title Competition of pairing and P eierls--charge-density-wave correlations in a two-dimensional electron-phonon model , \ 10.1103/PhysRevB.40.197 journal journal Phys. Rev. B \...

    doi

  28. [38]

    Marsiglio ,\ title title Pairing and charge-density-wave correlations in the H olstein model at half-filling , \ 10.1103/PhysRevB.42.2416 journal journal Phys

    author author F. Marsiglio ,\ title title Pairing and charge-density-wave correlations in the H olstein model at half-filling , \ 10.1103/PhysRevB.42.2416 journal journal Phys. Rev. B \ volume 42 ,\ pages 2416 ( year 1990 ) NoStop

    1990 doi

  29. [39]

    author author JK Freericks , author M Jarrell , \ and\ author DJ Scalapino ,\ title title Holstein model in infinite dimensions , \ https://journals.aps.org/prb/abstract/10.1103/PhysRevB.48.6302 journal journal Physical Review B \ volume 48 ,\ pages 6302 ( year 1993 ) NoStop

    doi

  30. [40]

    author author Takahiro \ Ohgoe \ and\ author Masatoshi \ Imada ,\ title title Competition among superconducting, antiferromagnetic, and charge orders with intervention by phase separation in the 2 D H olstein- H ubbard model , \ https://journals.aps.org/prl/abstract/10.1103/Ph...

    doi

  31. [41]

    Hohenadler \ and\ author G.G

    author author M. Hohenadler \ and\ author G.G. \ Batrouni ,\ title title Dominant charge density wave correlations in the H olstein model on the half-filled square lattice , \ 10.1103/PhysRevB.100.165114 journal journal Phys. Rev. B \ volume 100 ,\ pages 165114 ( year 2019 ) NoStop

    doi

  32. [42]

    \ Batrouni , \ and\ author Richard T

    author author Owen \ Bradley , author George G. \ Batrouni , \ and\ author Richard T. \ Scalettar ,\ title title Superconductivity and charge density wave order in the two-dimensional H olstein model , \ 10.1103/PhysRevB.103.235104 journal journal Phys. Rev. B \ volume 103 ,\ ...

    doi

  33. [43]

    Nosarzewski , author E

    author author B. Nosarzewski , author E. W. \ Huang , author Philip M. \ Dee , author I. Esterlis , author B. Moritz , author S. A. \ Kivelson , author S. Johnston , \ and\ author T. P. \ Devereaux ,\ title title Superconductivity, charge density waves, and bipolarons in the H...

    doi

  34. [44]

    \ Ara\'ujo , author Jos\'e P

    author author Maykon V. \ Ara\'ujo , author Jos\'e P. \ de Lima , author Sandro \ Sorella , \ and\ author Natanael C. \ Costa ,\ title title Two-dimensional t - t ^ H olstein model , \ 10.1103/PhysRevB.105.165103 journal journal Phys. Rev. B \ volume 105 ,\ pages 165103 ( year...

    doi

  35. [45]

    Weber \ and\ author M

    author author M. Weber \ and\ author M. Hohenadler ,\ title title Two-dimensional H olstein- H ubbard model: Critical temperature, I sing universality, and bipolaron liquid , \ 10.1103/PhysRevB.98.085405 journal journal Phys. Rev. B \ volume 98 ,\ pages 085405 ( year 2018 ) NoStop

    doi

  36. [46]

    \ Zhang , author W.-T

    author author Y.-X. \ Zhang , author W.-T. \ Chiu , author N.C. \ Costa , author G.G. \ Batrouni , \ and\ author R.T. \ Scalettar ,\ title title Charge order in the H olstein model on a honeycomb lattice , \ 10.1103/PhysRevLett.122.077602 journal journal Phys. Rev. Lett. \ vol...

    doi

  37. [47]

    Feng \ and\ author R

    author author C. Feng \ and\ author R. T. \ Scalettar ,\ title title Interplay of flat electronic bands with H olstein phonons , \ 10.1103/PhysRevB.102.235152 journal journal Phys. Rev. B \ volume 102 ,\ pages 235152 ( year 2020 ) NoStop

    doi

  38. [48]

    Chen , author X

    author author C. Chen , author X. Y. \ Xu , author Z. Y. \ Meng , \ and\ author M. Hohenadler ,\ title title Charge-density-wave transitions of D irac fermions coupled to phonons , \ 10.1103/PhysRevLett.122.077601 journal journal Phys. Rev. Lett. \ volume 122 ,\ pages 077601 (...

    doi

  39. [49]

    author author I Esterlis , author SA Kivelson , \ and\ author DJ Scalapino ,\ title title A bound on the superconducting transition temperature , \ https://www.nature.com/articles/s41535-018-0133-0 journal journal npj Quantum Materials \ volume 3 ,\ pages 1--4 ( year 2018 ) NoStop

    2018

  40. [50]

    author author Evert PL \ Van Nieuwenburg , author Ye-Hua \ Liu , \ and\ author Sebastian D \ Huber ,\ title title Learning phase transitions by confusion , \ https://www.nature.com/articles/nphys4037 journal journal Nature Physics \ volume 13 ,\ pages 435--439 ( year 2017 ) NoStop

    2017

  41. [51]

    a fer , \ and\ author Niels \ L \

    author author Julian \ Arnold , author Frank \ Sch \"a fer , \ and\ author Niels \ L \"o rch ,\ title title Fast detection of phase transitions with multi-task learning-by-confusion , \ https://arxiv.org/pdf/2311.09128 journal journal arXiv preprint arXiv:2311.09128 \ ( year 2...

    2023 arXiv

  42. [52]

    author author Song Sub \ Lee \ and\ author Beom Jun \ Kim ,\ title title Confusion scheme in machine learning detects double phase transitions and quasi-long-range order , \ https://journals.aps.org/pre/pdf/10.1103/PhysRevE.99.043308 journal journal Physical Review E \ volume ...

    doi

  43. [53]

    author author Matthew JS \ Beach , author Anna \ Golubeva , \ and\ author Roger G \ Melko ,\ title title Machine learning vortices at the K osterlitz- T houless transition , \ https://journals.aps.org/prb/pdf/10.1103/PhysRevB.97.045207 journal journal Physical Review B \ volum...

    doi

  44. [54]

    author author Monika \ Richter-Laskowska , author Marcin \ Kurpas , \ and\ author Maciej M \ Ma \'s ka ,\ title title Learning by confusion approach to identification of discontinuous phase transitions , \ https://journals.aps.org/pre/abstract/10.1103/PhysRevE.108.024113 journ...

    doi

  45. [55]

    author author Maxim A \ Gavreev , author Alena S \ Mastiukova , author Evgeniy O \ Kiktenko , \ and\ author Aleksey K \ Fedorov ,\ title title Learning entanglement breakdown as a phase transition by confusion , \ https://iopscience.iop.org/article/10.1088/1367-2630/ac7fb2/pdf...

    doi

  46. [56]

    author author Daria \ Zvyagintseva , author Helgi \ Sigurdsson , author Valerii K \ Kozin , author Ivan \ Iorsh , author Ivan A \ Shelykh , author Vladimir \ Ulyantsev , \ and\ author Oleksandr \ Kyriienko ,\ title title Machine learning of phase transitions in nonlinear polar...

    2022

  47. [57]

    author author Ya A \ Kharkov , author VE Sotskov , author AA Karazeev , author Evgeniy O \ Kiktenko , \ and\ author Aleksey K \ Fedorov ,\ title title Revealing quantum chaos with machine learning , \ https://journals.aps.org/prb/pdf/10.1103/PhysRevB.101.064406 journal journal...

    doi

  48. [58]

    a fer , author Niels \ L \

    author author Eliska \ Greplova , author Agnes \ Valenti , author Gregor \ Boschung , author Frank \ Sch \"a fer , author Niels \ L \"o rch , \ and\ author Sebastian D \ Huber ,\ title title Unsupervised identification of topological phase transitions using predictive models ,...

    doi

  49. [59]

    Bohrdt , author S

    author author A. Bohrdt , author S. Kim , author A. Lukin , author M. Rispoli , author R. Schittko , author M. Knap , author M. Greiner , \ and\ author J. L\'eonard ,\ title title Analyzing nonequilibrium quantum states through snapshots with artificial neural networks , \ 10....

    doi

  50. [60]

    author author Cesare \ Franchini , author Michele \ Reticcioli , author Martin \ Setvin , \ and\ author Ulrike \ Diebold ,\ title title Polarons in materials , \ https://www.nature.com/articles/s41578-021-00289-w.pdf journal journal Nature Reviews Materials \ volume 6 ,\ pages...

    2021

  51. [61]

    author author Nikolai V \ Prokof'ev \ and\ author Boris V \ Svistunov ,\ title title Polaron problem by diagrammatic quantum M onte C arlo , \ https://journals.aps.org/prl/pdf/10.1103/PhysRevLett.81.2514 journal journal Physical Review Letters \ volume 81 ,\ pages 2514 ( year ...

    doi

  52. [62]

    author author Ben J \ Powell ,\ title title An introduction to effective low-energy H amiltonians in condensed matter physics and chemistry , \ https://arxiv.org/pdf/0906.1640 journal journal arXiv preprint arXiv:0906.1640 \ ( year 2009 ) NoStop

    2009 arXiv

  53. [63]

    author author B Cohen-Stead , author K Barros , author ZY Meng , author C Chen , author RT Scalettar , \ and\ author GG Batrouni ,\ title title Langevin simulations of the half-filled cubic H olstein model , \ https://journals.aps.org/prb/abstract/10.1103/PhysRevB.102.161108 j...

    doi

  54. [64]

    author author Philip M \ Dee , author Ken \ Nakatsukasa , author Yan \ Wang , \ and\ author Steven \ Johnston ,\ title title Temperature-filling phase diagram of the two-dimensional holstein model in the thermodynamic limit by self-consistent migdal approximation , \ https://j...

    doi

  55. [65]

    i , \ https://journals.aps.org/prd/abstract/10.1103/PhysRevD.24.2278 journal journal Phys

    author author R Blankenbecler , author DJ Scalapino , \ and\ author RL Sugar ,\ title title Monte C arlo calculations of coupled boson-fermion systems. i , \ https://journals.aps.org/prd/abstract/10.1103/PhysRevD.24.2278 journal journal Phys. Rev. D \ volume 24 ,\ pages 2278 (...

    doi

  56. [66]

    author author S. R. \ White , author D. J. \ Scalapino , author R. L. \ Sugar , author E. Y. \ Loh , author J. E. \ Gubernatis , \ and\ author R. T. \ Scalettar ,\ title title Numerical study of the two-dimensional H ubbard model , \ 10.1103/PhysRevB.40.506 journal journal Phy...

    doi

  57. [67]

    author author E. Y. \ Loh , author J. E. \ Gubernatis , author R. T. \ Scalettar , author S. R. \ White , author D. J. \ Scalapino , \ and\ author R. L. \ Sugar ,\ title title Sign problem in the numerical simulation of many-electron systems , \ 10.1103/PhysRevB.41.9301 journa...

    doi

  58. [68]

    author author V. I. \ Iglovikov , author E. Khatami , \ and\ author R. T. \ Scalettar ,\ title title Geometry dependence of the sign problem in quantum M onte C arlo simulations , \ 10.1103/PhysRevB.92.045110 journal journal Phys. Rev. B \ volume 92 ,\ pages 045110 ( year 2015...

    doi

  59. [69]

    Mondaini , author S

    author author R. Mondaini , author S. Tarat , \ and\ author R. T. \ Scalettar ,\ title title Quantum critical points and the sign problem , \ 10.1126/science.abg9299 journal journal Science \ volume 375 ,\ pages 418--424 ( year 2022 ) NoStop

    doi

  60. [70]

    author author B Cohen-Stead , author C Bradley , O Miles , author GG Batrouni , author RT Scalettar , \ and\ author K Barros ,\ title title Fast and scalable quantum M onte C arlo simulations of electron-phonon models , \ https://journals.aps.org/pre/abstract/10.1103/PhysRevE....

    doi

  61. [71]

    author author R. T. \ Scalettar , author D. J. \ Scalapino , author R. L. \ Sugar , \ and\ author D. Toussaint ,\ title title Hybrid molecular-dynamics algorithm for the numerical simulation of many-electron systems , \ 10.1103/PhysRevB.36.8632 journal journal Phys. Rev. B \ v...

    doi

  62. [72]

    author author Thereza \ Paiva , author R. T. \ Scalettar , author Carey \ Huscroft , \ and\ author A. K. \ McMahan ,\ title title Signatures of spin and charge energy scales in the local moment and specific heat of the half-filled two-dimensional H ubbard model , \ 10.1103/Phy...

    doi

  63. [73]

    \ Melko , \ and\ author Ehsan \ Khatami ,\ title title Machine learning phases of strongly correlated fermions , \ 10.1103/PhysRevX.7.031038 journal journal Phys

    author author Kelvin \ Ch'ng , author Juan \ Carrasquilla , author Roger G. \ Melko , \ and\ author Ehsan \ Khatami ,\ title title Machine learning phases of strongly correlated fermions , \ 10.1103/PhysRevX.7.031038 journal journal Phys. Rev. X \ volume 7 ,\ pages 031038 ( ye...

    doi

  64. [74]

    author author Rajiv R. P. \ Singh \ and\ author Richard T. \ Scalettar ,\ title title Exact demonstration of pairing in the ground state of an attractive- U H ubbard model , \ 10.1103/PhysRevLett.66.3203 journal journal Phys. Rev. Lett. \ volume 66 ,\ pages 3203--3204 ( year 1...

    doi

  65. [75]

    \ Scalettar ,\ title title Charge density waves on a half-filled decorated honeycomb lattice , \ 10.1103/PhysRevB.101.205103 journal journal Phys

    author author Chunhan \ Feng , author Huaiming \ Guo , \ and\ author Richard T. \ Scalettar ,\ title title Charge density waves on a half-filled decorated honeycomb lattice , \ 10.1103/PhysRevB.101.205103 journal journal Phys. Rev. B \ volume 101 ,\ pages 205103 ( year 2020 ) NoStop

    doi

  66. [76]

    author author Kurt \ Binder ,\ title title Finite size scaling analysis of ising model block distribution functions , \ https://link.springer.com/content/pdf/10.1007/bf01293604.pdf journal journal Zeitschrift f \"u r Physik B Condensed Matter \ volume 43 ,\ pages 119--140 ( ye...

    doi

  67. [77]

    author author Kurt \ Binder \ and\ author DP Landau ,\ title title Finite-size scaling at first-order phase transitions , \ https://journals.aps.org/prb/pdf/10.1103/PhysRevB.30.1477 journal journal Physical Review B \ volume 30 ,\ pages 1477 ( year 1984 ) NoStop

    doi

  68. [78]

    author author Anders W \ Sandvik ,\ title title Finite-size scaling of the ground-state parameters of the two-dimensional H eisenberg model , \ https://journals.aps.org/prb/pdf/10.1103/PhysRevB.56.11678 journal journal Physical Review B \ volume 56 ,\ pages 11678 ( year 1997 ) NoStop

    doi

Pith tools

Reviewed August 10, 2026 · model on record in the stance chip above.