Pith. sign in

REVIEW 3 major objections 5 minor 85 references

Scylla: Observational Evidence for an Order of Magnitude in Dust Mass Opacity Evolution with ISM Density in the Large Magellanic Cloud

T0 review · 3 major / 5 minor · reviewed 2026-08-08 · deepseek-v4-flash

Pith's one-line read Using matched far-infrared emission and visible extinction toward the Large Magellanic Cloud, this paper shows that dust mass opacity in the far-infrared increases with gas surface density, varying by nearly an order of magnitude across…

desk verdict A real 15-pc LMC measurement that the FIR/optical dust opacity ratio rises with gas density, but the headline order-of-magnitude in kappa_160 is a re-expression of the fit, not an independent calibration. read the letter →

arxiv 2608.05325 v1 pith:PMYWLD5X submitted 2026-08-05 astro-ph.GA

classification astro-ph.GA
keywords interstellardustmassopacityemissivityfar-infraredemissionextinctionLargeMagellanicCloudmediumdensitygraingrowth
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper uses matched measurements of far-infrared dust emission and visible extinction toward the Large Magellanic Cloud to ask why the two standard ways of weighing dust disagree. It argues that the disagreement is not a measurement error but a physical trend: dust grains become more emissive per unit mass as the surrounding gas surface density rises. The ratio of the two dust-mass estimates, which is proportional to the ratio of far-infrared to optical dust opacity, increases by nearly an order of magnitude across $\Sigma_H = 4\!-\!100\,M_\odot\,\mathrm{pc}^{-2}$, implying that the opacity at 160 microns ranges from about $0.3\!-\!6\,\mathrm{m^2\,kg^{-1}}$. If correct, emission-based dust mass estimates in galaxies are systematically biased by up to an order of magnitude depending on local ISM density, and the reported trend supports theoretical models of grain growth via coagulation and ice mantles in dense regions.

What carries the argument

The central object is the ratio $\Sigma_{D,\mathrm{FIR}}/\Sigma_{D,A_V}$, which the paper uses as a proxy for the dust mass opacity ratio $\kappa_{\mathrm{FIR}}/\kappa_V$. Because both dust-mass estimates are obtained by dividing an observable (FIR intensity or visual extinction) by an assumed constant opacity, the true, unknown opacities cancel out of the ratio, leaving a direct measure of how the assumed opacity ratio misrepresents the true one; unity means the assumed opacities are correct. The machinery that makes the argument work is the matched-resolution comparison (60 arcseconds, 15 pc) of emission-based $\Sigma_D$ from feathered Herschel maps and extinction-based $\Sigma_D$ from the Scylla and METAL $A_V$ maps, with $\Sigma_H$ from HI and CO maps. The paper also uses the posterior distributions of the SED fits (1000 samples per pixel) to bootstrap the correlation, and it uses grain-size-dependent $\kappa_V$ models to argue that grain growth alone cannot produce the full slope.

What would settle it

Fit the same sightlines with a multi-component or temperature-constrained SED using MIR-to-submillimeter bands with per-pixel temperatures, and recompute the $\Sigma_{D,\mathrm{FIR}}/\Sigma_{D,A_V}$ versus $\Sigma_H$ slope; if the slope flattens to zero after temperature is explicitly accounted for, the opacity-evolution claim would be refuted.

Watch

Extended reading notes

Core claim

In the paper's own terms: comparing dust mass surface densities from FIR emission ($\Sigma_{D,\mathrm{FIR}}$) and visible extinction ($\Sigma_{D,A_V}$) at 15 pc resolution toward the LMC, the ratio $\Sigma_{D,\mathrm{FIR}}/\Sigma_{D,A_V}$ is proportional to $\kappa_{\mathrm{FIR}}/\kappa_V$ and is correlated with total hydrogen surface density $\Sigma_H$ as $\log_{10}(\Sigma_{D,\mathrm{FIR}}/\Sigma_{D,A_V}) = 0.80\,\log_{10}(\Sigma_H) - 0.94$ (Equation 5, $R^2 = 0.67\pm0.08$). This slope means that FIR dust opacity increases with ISM density: the extinction-corrected opacity at 160 microns spans $0.3\!-\!6\,\mathrm{m^2\,kg^{-1}}$ across the observed density range, rather than being the constant $1.24\,\mathrm{m^2\,kg^{-1}}$ assumed in the fits. The paper shows that plausible variations in $\kappa_V$ from grain growth explain only about half of the observed slope, so an increase in $\kappa_{\mathrm{FIR}}$ is required to produce the full trend. The positive slope is reproduced with an independent emission map (slope 0.75, $R^2 = 0.53$), strengthening the claim that the trend is not an artifact of one SED model; the paper attributes the opposite (negative) trend found in earlier kiloparsec-resolution studies to unresolved temperature mixtures at coarse resolution.

Load-bearing premise

The claim rests on the assumption that the dust temperature recovered from the emission SED fits is correct for each sightline, so that the ratio $\Sigma_{D,\mathrm{FIR}}/\Sigma_{D,A_V}$ traces true opacity rather than temperature; if a residual temperature-density degeneracy drives the trend, the opacity interpretation weakens.

Editorial extensions

If this is right

  • Emission-based dust mass estimates for galaxies and regions will need a density-dependent opacity rather than a fixed value, otherwise masses are systematically over- or underestimated by up to about a factor of 10.
  • Dust-to-gas ratio maps derived from FIR emission, such as those of the LMC, will need recalibration as a function of $\Sigma_H$ if the opacity trend is correct.
  • The factor-of-1.8–2.5 offsets between FIR and extinction dust masses seen in the Milky Way, SMC, and M31 can be understood as the same density-driven opacity evolution rather than unrelated systematics.
  • The direction of the opacity–density relation reverses at kiloparsec scales because temperature mixtures dominate, implying that high-resolution observations are required for reliable FIR opacity inference.
  • The inferred $\kappa_{160}$ range of $0.3\!-\!6\,\mathrm{m^2\,kg^{-1}}$ provides an observational grid for grain evolution models, including coagulation and mantle accretion predictions.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If the density dependence holds at other metallicities, the LMC slope is a first calibration point for a universal density-dependent FIR opacity law, but the slope may itself depend on metallicity and radiation field.
  • The same ratio method, applied to galaxies with both HST extinction and Herschel coverage such as M31 and M33, would test whether the positive slope is universal or specific to the LMC; a steeper or flatter slope in those galaxies would map how grain growth responds to metallicity.
  • The sharpest test is to break the temperature-opacity degeneracy with additional submillimeter bands or multi-component temperature fits; if the ratio-slope survives explicit temperature correction, the opacity interpretation is confirmed, and if it flattens, the trend is partly a temperature artifact.
  • A subtle consequence of rising $\kappa_{\mathrm{FIR}}$ with density is that FIR-derived dust masses of molecular clouds would be systematically inflated, which would in turn overstate dust-to-gas ratios and alter inferred gas depletion times and star formation efficiencies in dense regions.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 5 minor

Summary. The paper compares far-infrared (FIR) emission-based and optical-extinction-based dust mass surface density maps of the Large Magellanic Cloud, using new extinction maps from the Scylla survey and published FIR maps from Clark et al. (2023). The authors find that the ratio Σ_D,FIR/Σ_D,AV is moderately correlated with total hydrogen surface density Σ_H, with a fitted power-law slope of 0.80±0.12 and R²=0.67±0.08 (Eq. 5). They interpret this as evidence that the dust mass opacity ratio κ_FIR/κ_V increases with ISM density, and they use the fitted relation to derive a corrected κ_160 distribution spanning 0.3–6 m²/kg (Eq. 6, Figure 3). An appendix reproduces the positive slope (m=0.75, R²=0.53) using the independent Chastenet et al. (2019) dust map.

Significance. If the trend is real, this is a significant result: it would imply that emission-based dust mass estimates are systematically biased by up to an order of magnitude depending on local gas density, and it would provide observational support for grain-growth models predicting κ_FIR to increase with ISM density. The paper's strengths include the use of publicly available maps, bootstrapping that propagates the full posterior distributions of the dust maps, and an independent cross-check with a different SED model and additional MIR data. However, the central quantitative claim depends on controlling the dust-temperature–density degeneracy and on the assumed density dependence of κ_V; neither is fully closed in the current manuscript.

major comments (3)
  1. [Section 2 (temperature systematic) and Section 3, Eq. (5); Appendix A] The central interpretation that Σ_D,FIR/Σ_D,AV traces κ_FIR/κ_V requires that the SED-fitting procedure recover T_d without a systematic dependence on Σ_H. The manuscript itself identifies dust temperature as the 'leading systematic' (Section 2). The Appendix cross-check uses a different model (Draine et al. 2007) and adds Spitzer MIR bands, which improves temperature constraints, but it still fits a single effective radiation field per resolution element and shares the Herschel FIR bands. A residual T_d–Σ_H covariance is therefore not excluded. I recommend a direct test: include the fitted T_d (or a radiation-field proxy such as U_min) as a covariate in the regression, or restrict the sample to a narrow T_d range, and report whether the slope in Eq. (5) is robust. Without such a test, the headline order-of-magnitude claim, which is a direct function of that slope, remains vulnerable to the temperature degeneracy.
  2. [Section 4.2, Eq. (6) and Figure 3] The stated κ_160 = 0.3–6 m²/kg range is not an independent measurement. It is obtained by applying the fitted slope of Eq. (5) through Eq. (6) to the assumed κ_160 = 1.24 m²/kg. Consequently, the 'nearly an order of magnitude' range is essentially a restatement of the regression slope and inherits all systematic errors in that slope, including the temperature degeneracy and the κ_V assumption. The authors should clearly label this distribution as a model-dependent correction and propagate the slope uncertainty, including systematic contributions, into the κ_160 range. As written, Figure 3 gives the impression of a new measurement when it is a remapping of the correlation.
  3. [Section 4, κ_V correction paragraph] The claim that grain-size-driven variation of κ_V reduces the slope only to m≈0.56 rests on the predicted grain-size trend (0.1–0.5 µm) from Ysard et al. (2018), not on a measured density-dependent κ_V. Because the denominator Σ_D,AV would be underestimated in dense sightlines if the true κ_V is lower than the assumed constant, an overestimated κ_V variation could reduce the residual slope further than stated. The authors should quantify the sensitivity of the slope to the assumed κ_V(Σ_H) relation, for example by marginalizing over the grain-size model parameters or by adopting a conservative upper limit on κ_V variation, before concluding that a κ_FIR increase is still required.
minor comments (5)
  1. [Abstract and Section 1] The abstract states 'κ_160 = 0.3−6 m^2 kg^{-2}'; the units should be m² kg⁻¹ (per kg, not per kg²). The same typo appears in the abstract and possibly elsewhere.
  2. [Figure 2 caption] The caption reports 'Bootstrap: m = 0.80, b = 0.9', but Eq. (5) gives the intercept as −0.94 ± 0.19. Please correct the inconsistency in the caption.
  3. [Section 4.2] The text refers to 'the inverse linear relationship between κ_FIR and Σ_FIR (see Eq. 2.1)'; the relevant equation is Eq. (5) in Section 3, not Eq. 2.1.
  4. [Section 2.1] The sentence describing native pixel sizes (3.2″–14″) might be clearer if it noted that the maps were convolved to 36″ FWHM before SED fitting, as stated later in the same section.
  5. [Section 2.3 / Figure 1 caption] The text states that 60″ corresponds to 17 pc, while the Figure 1 caption says '60″/15-pc'. Please harmonize the distance scale.

Circularity Check

1 steps flagged · score 4.0 of 10

The headline κ_160 = 0.3–6 m²/kg range is Eq. 5 restated in opacity units; the underlying Σ_D,FIR/Σ_D,AV–Σ_H correlation is an independent, cross-checked observation.

  1. fitted input called prediction [Section 4.2, Eq. 6 / Figure 3; abstract]
    "Using the A_V-calibrated trend observed in Figure 2 (Eq. 5), we define a corrective factor to Σ_D,FIR and κ_160 as follows: χ160 = 10^{0.80 log10 Σ_H −0.94} (6) and apply this correction to κ_160 across all observed Σ_H environments."

    Eq. 6 is exactly the inverse-logarithm of the fitted regression in Eq. 5, sharing the same slope (0.80) and intercept (−0.94). The 'corrected' κ_160 values are therefore the observed Σ_D,FIR/Σ_D,AV ratio (the very quantity used to fit Eq. 5) rescaled by the assumed κ_160 = 1.24 normalization. The headline range κ_160 = 0.3–6 m²/kg is obtained by evaluating this fitted line over the observed Σ_H = 4–100 M_sun/pc² range, so it is the fit restated in opacity units rather than an independent prediction. The paper does label this a 'corrective factor' and 'rudimentary estimate,' limiting the circularity to the presentation of the derived κ range as a new finding.

full rationale

The paper's primary empirical result — the positive log-linear correlation between Σ_D,FIR/Σ_D,AV and Σ_H (Eq. 5, m = 0.80 ± 0.12) — is a direct comparison of two independent observables (extinction-based and emission-based dust columns) and does not reduce to its inputs; the Appendix reproduces the slope (m = 0.75) using the independent Chastenet et al. (2019) map with a different SED model and MIR data, providing genuine external support. The only self-referential step is the conversion of that fitted relation into the 'corrected' κ_160 = 0.3–6 range (Eq. 6), which is the antilog of Eq. 5 applied to the assumed κ_160 = 1.24; these opacity values are a restatement of the measured ratio, not an independent derivation. The paper is transparent that this is a 'corrective factor' and a 'rudimentary estimate,' so this is a presentation issue rather than a load-bearing circularity. The acknowledged leading systematic (dust temperature, Section 2) is a physical degeneracy that could affect the slope, but it is a correctness risk, not a circularity. Self-citations to the authors' own map papers are normal data references and are not load-bearing; the Chastenet cross-check is external. Overall, the central claim retains independent empirical content; only the headline opacity normalization reduces by construction.

Assumptions & free parameters 2 free parameters · 4 assumptions · 0 invented entities

The central claim rests on the assumption that the FIR-to-extinction ratio cleanly traces the opacity ratio, with temperature as a stated leading systematic. The paper introduces no new entities. The main hand-chosen elements are the A_V quality cuts and the κ_V variation model used to parse the slope.

free parameters (2)
  • A_V quality-cut bounds = A_V = 0.6-2.0 mag (chosen bounds)
    These bounds select 208 of 510 sightlines and are motivated in Section 2.4 by foreground uncertainty and sampling noise. The analysis does not show whether the trend persists outside this range, so the fitted slope could depend on the cut choices.
  • κ_V density-variation model = factor 3-4 decrease (3000 to 1000 m²/kg)
    Assumed in Section 4 based on Ysard et al. (2018) grain models. It is used to split the observed slope into κ_V and κ_FIR contributions; if this model is wrong, the inferred κ_FIR increase changes.
assumptions (4)
  • domain assumption The ratio Σ_D,FIR/Σ_D,AV is proportional to κ_FIR/κ_V for each sightline.
    Stated in Section 2 and via Eqs. 1-4. Requires both probes trace the same dust column and that all other systematics (temperature, submm excess, grain size distribution) are subdominant. The paper identifies temperature as the leading systematic.
  • domain assumption The dust temperature is adequately constrained so that density-dependent temperature variations do not drive the observed trend.
    The paper argues temperature is subdominant (Section 2) and the Chastenet cross-check uses a different model, but a remaining degeneracy between Σ_H and T_d could bias the slope.
  • ad hoc to paper The assumed κ_V grain-growth model (Ysard et al. 2018) correctly predicts how κ_V varies with ISM density.
    Used in Section 4 to split the slope into κ_V and κ_FIR contributions. This is an external calibration, not measured in this paper.
  • standard math Standard modified blackbody emission in the optically thin regime (Eq. 1) and the A_V = 1.086 κ_V Σ_D relation (Eq. 4).
    Standard astrophysical relations, cited to Draine (2003) and Draine et al. (2014).

how reviews work

0 comments
Cite this review

Pith. "Pith review of Scylla: Observational Evidence for an Order of Magnitude in Dust Mass Opacity Evolution with ISM Density in the Large Magellanic Cloud." pith.science (2026). https://pith.science/paper/PMYWLD5X

@misc{pith2026260805325,
  author       = {Pith},
  title        = {Pith review of: Scylla: Observational Evidence for an Order of Magnitude in Dust Mass Opacity Evolution with ISM Density in the Large Magellanic Cloud},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/PMYWLD5X}},
  note         = {Machine review of arXiv:2608.05325}
}
abstract

The emissivity of dust is known to vary greatly with radiative environment, density, grain chemistry, and geometry. Discrepancies between dust mass surface densities derived from far-infrared (FIR) emission and visible extinction persist across and within galaxies in the local Universe. Here, we use new extinction and emission measurements towards the LMC to show that this discrepancy is driven by the dust mass opacity evolving with the intrinsic density of the ISM, and that the ratio between FIR and optical dust mass opacity varies with gas surface density. These new findings imply that the dust mass opacity in the FIR could increase by nearly an order of magnitude (e.g., $\kappa_{160} = 0.3 - 6\ m^2\ kg^{-2}$) across over an order of magnitude of total hydrogen surface density $(\Sigma_H = 4 - 100 M_{\odot}\ pc^{-2})$, corroborating previous theoretical models for dust mass opacity evolution in the FIR, and providing new implications for emission-based dust mass estimates.

Figures

Figures reproduced from arXiv: 2608.05325 by the authors.

Figure 2
Figure 2. Ratio of ΣD versus ΣH: Ratio of extinction and emission-based dust mass surface densities (ΣD, F IR/ΣD, AV ) versus total hydrogen surface density (ΣH), for 208 sightlines with AV = 0.6 − 2.0 mag, convolved to a resolution of 60′′ (15 pc). The y-axis is proportional to κFIR/κV . greater than ΣD, AV , while values less than one suggest the inverse. Observed fields span a factor of 20 in hydrogen sur￾face densities (Σ… view at source ↗
Figure 3
Figure 3. Corrected dust mass opacity in the LMC: Histogram of extinction-corrected dust mass opacity (κ160) values for all ISM regions measured in the LMC. Compared to existing literature measurements of κ160, both in the LMC and SMC (e.g., K. D. Gordon et al. 2014, 2017; J. Roman– Duval et al. 2017) and beyond (e.g., M101, 22 other galaxies, I.-D. Chiang et al. 2018; C. J. R. Clark et al. 2016, respec￾tively), these new inf… view at source ↗
Figure 4
Figure 4. As [PITH_FULL_IMAGE:figures/full_fig_p012_4.png] view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

85 extracted references · 32 canonical work pages

  1. [1]

    The Quest for the Missing Dust. II. Two Orders of Magnitude of Evolution in the Dust-to-gas Ratio Resolved within Local Group Galaxies. , keywords =. doi:10.3847/1538-4357/acbb66 , archivePrefix =. 2302.07378 , primaryClass =

  2. [2]

    , archivePrefix = "arXiv", eprint =

    HI4PI: A full-sky H I survey based on EBHIS and GASS. , archivePrefix = "arXiv", eprint =. doi:10.1051/0004-6361/201629178 , adsurl =

  3. [3]

    E(B-V), N(H I) and N(H_2)

    E(B - V), N(H I), and N(H _ 2 ). , keywords =. doi:10.1088/0004-637X/783/1/17 , archivePrefix =. 1401.1837 , primaryClass =

  4. [4]

    Planck early results. I. The Planck mission. , keywords =. doi:10.1051/0004-6361/201116464 , archivePrefix =. 1101.2022 , primaryClass =

  5. [5]

    , keywords =

    Common-Resolution Convolution Kernels for Space- and Ground-Based Telescopes. , keywords =. doi:10.1086/662219 , archivePrefix =. 1106.5065 , primaryClass =

  6. [6]

    Spitzer Survey of the Large Magellanic Cloud: Surveying the Agents of a Galaxy's Evolution (SAGE). I. Overview and Initial Results. , keywords =. doi:10.1086/508185 , archivePrefix =. astro-ph/0606356 , primaryClass =

  7. [7]

    The Polycyclic Aromatic Hydrocarbon Mass Fraction on a 10 pc scale in the Magellanic Clouds

    The Polycyclic Aromatic Hydrocarbon Mass Fraction on a 10 pc Scale in the Magellanic Clouds. , keywords =. doi:10.3847/1538-4357/ab16cf , archivePrefix =. 1904.02705 , primaryClass =

  8. [8]

    Astronomical Society of India Conference Series , year = 2010, series =

    Internal and foreground reddening maps of the Magellanic Clouds. Astronomical Society of India Conference Series , year = 2010, series =

Show all 85 references
  1. [9]

    , keywords =

    Dust distributions in the magellanic clouds. , keywords =. doi:10.1093/mnras/stac072 , archivePrefix =. 2201.03152 , primaryClass =

  2. [10]

    Scylla. I. A Pure-parallel, Multiwavelength Imaging Survey of the ULLYSES Fields in the LMC and SMC. , keywords =. doi:10.3847/1538-4365/ad6de2 , archivePrefix =. 2410.11695 , primaryClass =

  3. [11]

    Infrared Spaceborne Remote Sensing , year = 1993, editor =

    Design of the diffuse infrared background experiment (DIRBE) on COBE. Infrared Spaceborne Remote Sensing , year = 1993, editor =. doi:10.1117/12.157825 , adsurl =

  4. [12]

    , keywords =

    The COBE Mission: Its Design and Performance Two Years after Launch. , keywords =. doi:10.1086/171797 , adsurl =

  5. [13]

    , keywords =

    The Infrared Astronomical Satellite (IRAS) mission. , keywords =. doi:10.1086/184209 , adsurl =

  6. [14]

    , keywords =

    The HERSCHEL Inventory of The Agents of Galaxy Evolution in the Magellanic Clouds, a Herschel Open Time Key Program. , keywords =. doi:10.1088/0004-6256/146/3/62 , adsurl =

  7. [15]

    , keywords =

    Dust Masses, PAH Abundances, and Starlight Intensities in the SINGS Galaxy Sample. , keywords =. doi:10.1086/518306 , archivePrefix =. astro-ph/0703213 , primaryClass =

  8. [16]

    Planck intermediate results. XXIX. All-sky dust modelling with Planck, IRAS, and WISE observations. , keywords =. doi:10.1051/0004-6361/201424945 , archivePrefix =. 1409.2495 , primaryClass =

  9. [17]

    Gass: The Parkes Galactic All-Sky Survey. I. Survey Description, Goals, and Initial Data Release. , keywords =. doi:10.1088/0067-0049/181/2/398 , archivePrefix =. 0901.1159 , primaryClass =

  10. [18]

    , keywords =

    The apparent anticorrelation between the mass opacity of interstellar dust and the surface density of interstellar gas. , keywords =. doi:10.1093/mnrasl/slaa034 , archivePrefix =. 2002.07485 , primaryClass =

  11. [19]

    , keywords =

    Dust emissivity in resolved spiral galaxies. , keywords =. doi:10.1051/0004-6361/202243930 , archivePrefix =. 2206.13375 , primaryClass =

  12. [20]

    , keywords =

    Dust emissivity and absorption cross section in DustPedia late-type galaxies. , keywords =. doi:10.1051/0004-6361/201936314 , archivePrefix =. 1909.12692 , primaryClass =

  13. [21]

    , keywords =

    Non-standard grain properties, dark gas reservoir, and extended submillimeter excess, probed by Herschel in the Large Magellanic Cloud. , keywords =. doi:10.1051/0004-6361/201117952 , archivePrefix =. 1110.1260 , primaryClass =

  14. [22]

    , keywords =

    Dust Abundance Variations in the Magellanic Clouds: Probing the Life-cycle of Metals with All-sky Surveys. , keywords =. doi:10.3847/1538-4357/aa7067 , archivePrefix =. 1705.03049 , primaryClass =

  15. [23]

    , keywords =

    An empirical determination of the dust mass absorption coefficient, _ d , using the Herschel Reference Survey. , keywords =. doi:10.1093/mnras/stw647 , archivePrefix =. 1603.04860 , primaryClass =

  16. [24]

    , keywords =

    The Spatially Resolved Dust-to-metals Ratio in M101. , keywords =. doi:10.3847/1538-4357/aadc5f , archivePrefix =. 1808.07164 , primaryClass =

  17. [25]

    , keywords =

    The Recent LMC-SMC Collision: Timing and Impact Parameter Constraints from Comparison of Gaia LMC Disk Kinematics and N-body Simulations. , keywords =. doi:10.3847/1538-4357/ac4e90 , archivePrefix =. 2201.04648 , primaryClass =

  18. [26]

    , keywords =

    A Galactic Eclipse: The Small Magellanic Cloud Is Forming Stars in Two Superimposed Systems. , keywords =. doi:10.3847/1538-4357/ad1591 , archivePrefix =. 2312.07750 , primaryClass =

  19. [27]

    The Quest for the Missing Dust. I. Restoring Large-scale Emission in Herschel Maps of Local Group Galaxies. , keywords =. doi:10.3847/1538-4357/ac16d4 , archivePrefix =. 2107.14302 , primaryClass =

  20. [28]

    , keywords =

    The first maps of _ d - the dust mass absorption coefficient - in nearby galaxies, with DustPedia. , keywords =. doi:10.1093/mnras/stz2257 , archivePrefix =. 1908.04318 , primaryClass =

  21. [29]

    , keywords =

    Ashes of FIRE: Modeling Dust Grain Size Evolution in the Local Group with FIRE. , keywords =. doi:10.1093/mnras/stag1020 , archivePrefix =. 2603.08504 , primaryClass =

  22. [30]

    , keywords =

    Dust Grain Size Distributions from MRN to MEM. , keywords =. doi:10.1086/374316 , archivePrefix =. astro-ph/0301488 , primaryClass =

  23. [31]

    Low-temperature MIR to submillimeter mass absorption coefficient of interstellar dust analogues. II. Mg and Fe-rich amorphous silicates. , keywords =. doi:10.1051/0004-6361/201730944 , archivePrefix =. 1706.09801 , primaryClass =

  24. [32]

    Low temperature MIR to submillimeter mass absorption coefficient of interstellar dust analogues. I. Mg-rich glassy silicates. , keywords =. doi:10.1051/0004-6361/201629711 , archivePrefix =. 1701.07225 , primaryClass =

  25. [33]

    Scylla. VI. Parsec-scale Dust Extinction Maps in the SMC and LMC. , keywords =. doi:10.3847/1538-4357/ae6b7e , archivePrefix =. 2605.06925 , primaryClass =

  26. [34]

    Scylla. IV. Intrinsic Stellar Properties and Line-of-sight Dust Extinction Measurements toward 1.5 Million Stars in the SMC and LMC. , keywords =. doi:10.3847/1538-4357/adb4e8 , archivePrefix =. 2410.19910 , primaryClass =

  27. [35]

    The Panchromatic Hubble Andromeda Treasury. XV. The BEAST: Bayesian Extinction and Stellar Tool. , keywords =. doi:10.3847/0004-637X/826/2/104 , archivePrefix =. 1606.06182 , primaryClass =

  28. [36]

    Dust and Gas in the Magellanic Clouds from the HERITAGE Herschel Key Project. I. Dust Properties and Insights into the Origin of the Submillimeter Excess Emission. , keywords =. doi:10.1088/0004-637X/797/2/85 , archivePrefix =. 1406.6066 , primaryClass =

  29. [37]

    , keywords =

    Three-dimensional Structure and Dust Extinction in the Small Magellanic Cloud. , keywords =. doi:10.3847/1538-4357/abc48b , archivePrefix =. 2010.11181 , primaryClass =

  30. [38]

    The Panchromatic Hubble Andromeda Treasury. VIII. A Wide-area, High-resolution Map of Dust Extinction in M31. , keywords =. doi:10.1088/0004-637X/814/1/3 , archivePrefix =. 1509.06988 , primaryClass =

  31. [39]

    , keywords =

    Andromeda's Dust. , keywords =. doi:10.1088/0004-637X/780/2/172 , archivePrefix =. 1306.2304 , primaryClass =

  32. [40]

    , keywords =

    THEMIS 2.0: A self-consistent model for dust extinction, emission, and polarisation. , keywords =. doi:10.1051/0004-6361/202348391 , archivePrefix =. 2401.07739 , primaryClass =

  33. [41]

    , keywords =

    The global dust modelling framework THEMIS. , keywords =. doi:10.1051/0004-6361/201630225 , archivePrefix =. 1703.00775 , primaryClass =

  34. [42]

    , keywords =

    Dust evolution in the transition towards the denser ISM: impact on dust temperature, opacity, and spectral index. , keywords =. doi:10.1051/0004-6361/201525646 , archivePrefix =. 1506.01533 , primaryClass =

  35. [43]

    , keywords =

    From grains to pebbles: the influence of size distribution and chemical composition on dust emission properties. , keywords =. doi:10.1051/0004-6361/201936089 , archivePrefix =. 1909.05015 , primaryClass =

  36. [44]

    , keywords =

    Dust variations in the diffuse interstellar medium: constraints on Milky Way dust from Planck-HFI observations. , keywords =. doi:10.1051/0004-6361/201425523 , archivePrefix =. 1503.07435 , primaryClass =

  37. [45]

    , keywords =

    Dust coagulation processes as constrained by far-infrared observations. , keywords =. doi:10.1051/0004-6361/201218975 , adsurl =

  38. [46]

    Tying up a few loose ends

    Dust evolution, a global view: IV. Tying up a few loose ends. arXiv e-prints , keywords =. doi:10.48550/arXiv.1804.10628 , archivePrefix =. 1804.10628 , primaryClass =

  39. [47]

    , keywords =

    Modeling the Infrared Emission from the HD 141569A Disk. , keywords =. doi:10.1086/376939 , archivePrefix =. astro-ph/0311070 , primaryClass =

  40. [48]

    Mantle formation, coagulation, and the origin of cloud/core shine. I. Modelling dust scattering and absorption in the infrared. , keywords =. doi:10.1051/0004-6361/201527488 , archivePrefix =. 1602.00538 , primaryClass =

  41. [49]

    , keywords =

    The optical properties of dust: the effects of composition, size, and structure. , keywords =. doi:10.1051/0004-6361/201833386 , archivePrefix =. 1806.05420 , primaryClass =

  42. [50]

    Erratum: Dust and Gas in the Magellanic Clouds from the HERITAGE Herschel Key Project. I. Dust Properties and Insights into the Origin of the Submm Excess Emission (<A href=``https://doi.org/10.1088/0004-637x/797/2/85''>2014, ApJ, 797, 85</A>). , year = 2017, month = mar, volu...

  43. [51]

    , keywords =

    A Neutral Hydrogen Survey of the Large Magellanic Cloud: Aperture Synthesis and Multibeam Data Combined. , keywords =. doi:10.1086/376980 , adsurl =

  44. [52]

    The Magellanic Mopra Assessment (MAGMA). I. The Molecular Cloud Population of the Large Magellanic Cloud. , keywords =. doi:10.1088/0067-0049/197/2/16 , archivePrefix =. 1108.5715 , primaryClass =

  45. [53]

    The Panchromatic Hubble Andromeda Treasury: Triangulum Extended Region (PHATTER). I. Ultraviolet to Infrared Photometry of 22 Million Stars in M33. , keywords =. doi:10.3847/1538-4365/abdf4e , archivePrefix =. 2101.01293 , primaryClass =

  46. [54]

    , keywords =

    The Panchromatic Hubble Andromeda Treasury. , keywords =. doi:10.1088/0067-0049/200/2/18 , archivePrefix =. 1204.0010 , primaryClass =

  47. [55]

    II: H I and H _ 2 Column Densities

    The Atomic-to-Molecular Transition in Galaxies. II: H I and H _ 2 Column Densities. , keywords =. doi:10.1088/0004-637X/693/1/216 , archivePrefix =. 0811.0004 , primaryClass =

  48. [56]

    , keywords =

    Dust models post-Planck: constraining the far-infrared opacity of dust in the diffuse interstellar medium. , keywords =. doi:10.1051/0004-6361/201525677 , archivePrefix =. 1506.07011 , primaryClass =

  49. [57]

    doi:10.5281/zenodo.21262391 , url =

    Astropy Collaboration , title =. doi:10.5281/zenodo.21262391 , url =

  50. [58]

    arXiv , author =:1307.6212 , journal =

    doi:10.1051/0004-6361/201322068 , eid =. arXiv , author =:1307.6212 , journal =

  51. [59]

    , keywords =

    The Astropy Project: Building an Open-science Project and Status of the v2.0 Core Package. , keywords =. doi:10.3847/1538-3881/aabc4f , archiveprefix =. 1801.02634 , primaryclass =

  52. [60]

    , keywords =

    The Astropy Project: Sustaining and Growing a Community-oriented Open-source Project and the Latest Major Release (v5.0) of the Core Package. , keywords =. doi:10.3847/1538-4357/ac7c74 , archiveprefix =. 2206.14220 , primaryclass =

  53. [61]

    Hunter, J. D. , title =. Computing in Science & Engineering , volume =

  54. [62]

    Harris and K

    Charles R. Harris and K. Jarrod Millman and St. Array programming with. 2020 , month = sep, journal =. doi:10.1038/s41586-020-2649-2 , publisher =

  55. [63]

    , title =

    Van Rossum, Guido and Drake, Fred L. , title =. 2009 , isbn =

  56. [64]

    Ralf Gommers and Pauli Virtanen and Matt Haberland and Evgeni Burovski and Tyler Reddy and Warren Weckesser and Andrew Nelson and Travis E. Oliphant and David Cournapeau and Ilhan Polat and alexbrc and Pamphile Roy and Lucas Colley and Pearu Peterson and Josh Wilson and Jake B...

  57. [65]

    , keywords =

    The Interstellar Dust Properties of Nearby Galaxies. , keywords =. doi:10.1146/annurev-astro-081817-051900 , archivePrefix =. 1711.07434 , primaryClass =

  58. [66]

    , keywords =

    A Quantitative Comparison of the Small Magellanic Cloud, Large Magellanic Cloud, and Milky Way Ultraviolet to Near-Infrared Extinction Curves. , keywords =. doi:10.1086/376774 , archivePrefix =. astro-ph/0305257 , primaryClass =

  59. [67]

    , keywords =

    Modeling dust emission in the Magellanic Clouds with Spitzer and Herschel. , keywords =. doi:10.1051/0004-6361/201629133 , archivePrefix =. 1612.07598 , primaryClass =

  60. [68]

    METAL: The Metal Evolution, Transport, and Abundance in the Large Magellanic Cloud Hubble Program. III. Interstellar Depletions, Dust-to-Metal, and Dust-to-Gas Ratios versus Metallicity. , keywords =. doi:10.3847/1538-4357/ac5248 , archivePrefix =. 2202.04765 , primaryClass =

  61. [69]

    Dust depletion of metals from local to distant galaxies. II. Cosmic dust-to-metal ratio and dust composition. , keywords =. doi:10.1051/0004-6361/202347171 , archivePrefix =. 2310.07709 , primaryClass =

  62. [70]

    , keywords =

    Star Formation in the Milky Way and Nearby Galaxies. , keywords =. doi:10.1146/annurev-astro-081811-125610 , archivePrefix =. 1204.3552 , primaryClass =

  63. [71]

    , keywords =

    The CO-to-H _ 2 Conversion Factor and Dust-to-gas Ratio on Kiloparsec Scales in Nearby Galaxies. , keywords =. doi:10.1088/0004-637X/777/1/5 , archivePrefix =. 1212.1208 , primaryClass =

  64. [72]

    , keywords =

    The CO-to-H _ 2 Conversion Factor from Infrared Dust Emission across the Local Group. , keywords =. doi:10.1088/0004-637X/737/1/12 , archivePrefix =. 1102.4618 , primaryClass =

  65. [73]

    , year = 1983, month = sep, volume =

    The determination of cloud masses and dust characteristics from submillimetre thermal emission. , year = 1983, month = sep, volume =

  66. [74]

    , keywords =

    Fraction of bolometric luminosity absorbed by dust in DustPedia galaxies. , keywords =. doi:10.1051/0004-6361/201833699 , archivePrefix =. 1810.01208 , primaryClass =

  67. [75]

    , keywords =

    The bolometric and UV attenuation in normal spiral galaxies of the Herschel Reference Survey. , keywords =. doi:10.1051/0004-6361/201527586 , archivePrefix =. 1511.07430 , primaryClass =

  68. [76]

    , keywords =

    The global dust SED: tracing the nature and evolution of dust with DustEM. , keywords =. doi:10.1051/0004-6361/201015292 , archivePrefix =. 1010.2769 , primaryClass =

  69. [77]

    Astrophysics of Dust , year = 2004, editor =

    Extended Red Emission: Photoluminescence by Interstellar Nanoparticles. Astrophysics of Dust , year = 2004, editor =. doi:10.48550/arXiv.astro-ph/0309674 , archivePrefix =. astro-ph/0309674 , primaryClass =

  70. [78]

    The Physics and Chemistry of the Interstellar Medium

  71. [79]

    , keywords =

    Interstellar Dust Grains. , keywords =. doi:10.1146/annurev.astro.41.011802.094840 , archivePrefix =. astro-ph/0304489 , primaryClass =

  72. [80]

    and Haberland, Matt and Reddy, Tyler and Cournapeau, David and Burovski, Evgeni and Peterson, Pearu and Weckesser, Warren and Bright, Jonathan and

    Virtanen, Pauli and Gommers, Ralf and Oliphant, Travis E. and Haberland, Matt and Reddy, Tyler and Cournapeau, David and Burovski, Evgeni and Peterson, Pearu and Weckesser, Warren and Bright, Jonathan and. Nature Methods , year =

  73. [81]

    arXiv e-prints , keywords =

    Streamlining and standardizing software citations with The Software Citation Station. arXiv e-prints , keywords =

  74. [82]

    doi:10.5281/zenodo.17654855 , url =

    Tom Wagg and Floor Broekgaarden and Phil Van-Lane and Kai Wu and Kayhan Gültekin , title =. doi:10.5281/zenodo.17654855 , url =

  75. [83]

    , keywords =

    The Effect of Line-of-Sight Temperature Variation and Noise on Dust Continuum Observations. , keywords =. doi:10.1088/0004-637X/696/2/2234 , archivePrefix =. 0902.3477 , primaryClass =

  76. [84]

    , keywords =

    Dust opacities for protostellar cores. , keywords =

  77. [85]

    , keywords =

    Evolution of dust properties in an interstellar filament. , keywords =. doi:10.1051/0004-6361:20021309 , adsurl =

Pith tools

Reviewed August 8, 2026 · model on record in the stance chip above.