Pith. sign in

REVIEW 3 major objections 7 minor 48 references

Eclipsing Kitaev: off-diagonal exchange governs the correlated high-field phases of $\beta$-Li$_2$IrO$_3$

T0 review · 3 major / 7 minor · reviewed 2026-07-08 · glm-5.2

Pith's one-line read Off-diagonal Γ exchange eclipses Kitaev coupling in high-field magnet

desk verdict Clean experimental discovery of an ac-plane-only high-field phase in β-Li₂IrO₃, with a symmetry argument for why Γ exchange controls it — but the H⋆⋆ phase boundary rests on a derivative criterion applied to subtle pulsed-field features without independent thermodynamic confirmation. read the letter →

arxiv 2607.06463 v1 pith:6UPNZLGF submitted 2026-07-07 cond-mat.str-el

classification cond-mat.str-el
keywords exchangehigh-fieldcorrelatedkitaevmagneticphasesfieldsgamma
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper reports a high-field thermodynamic study of the hyperhoneycomb iridate β-Li₂IrO₃, a material long studied as a candidate Kitaev spin liquid. Using magnetotropic susceptibility (the second angular derivative of the magnetic free energy) measured via resonant torsion magnetometry in fields up to 60 T across all three principal crystallographic planes, the authors map the full low-temperature field-angle phase diagram. They discover that for magnetic fields applied in the ac-plane, the system does not evolve directly from its low-field incommensurate magnetic order into a trivial spin-polarized state. Instead, it passes through an additional intermediate correlated phase, bounded by a second transition field H⋆⋆, which is entirely absent when the field is rotated in the ab- or bc-planes. The paper explains this direction-dependent phase structure through a symmetry analysis of the minimal J-K-Γ model. The central mechanism is the off-diagonal exchange interaction Γ, which couples the ferromagnetic (uniform) and staggered (zigzag) magnetic order parameters via a cross-coupling energy term E_FG = -√2 Γ(F_a G_b + F_b G_a). For fields in the ac-plane, the only surviving crystal symmetry is the mirror operation ΘC₂b. The Γ-mediated cross-coupling drives a spontaneous breaking of this mirror symmetry above a threshold field, stabilizing the intermediate phase. In the ab-plane, no such coupling exists for the symmetry-allowed order parameters; in the bc-plane, the required symmetry is already unbroken in the low-field phase, making a coincident instability non-generic. The measured angular dependence of both critical fields is quantitatively reproduced by the J-K-Γ model, yielding exchange parameters J ∼ 0.5 ± 0.1 meV and Γ ∼ -11.5 ± 2.5 meV, consistent with but independent of prior neutron spectroscopy estimates. Crucially, the critical fields depend on J and Γ but are independent of the dominant Kitaev coupling K at leading order. The paper concludes that Γ exchange, not the Kitaev interaction, governs the high-field magnetic response, and that off-diagonal exchange stabilizes symmetry-constrained correlated phases that preempt the spin-polarized state, explaining why suppressing magnetic order in candidate Kitaev materials has not yielded a field-induced spin liquid.

What carries the argument

The cross-coupling energy term E_FG = -√2 Γ(F_a G_b + F_b G_a), where F is the uniform ferromagnetic magnetization, G is the staggered zigzag component, and Γ is the off-diagonal exchange. This term mixes uniform and staggered order and, for ac-plane field orientations, drives spontaneous breaking of the surviving mirror symmetry ΘC₂b, producing an intermediate phase with order parameters F_b, G_a, and G_c that grow as √(H⋆⋆ - H) near the upper transition.

What would settle it

If the H⋆⋆ feature in the ac-plane magnetotropic susceptibility is a crossover or derivative-analysis artifact rather than a genuine second-order phase transition, the symmetry-based explanation—while internally consistent—would lose its experimental anchor, and the claim that Γ drives a distinct symmetry-broken phase would be weakened.

Watch

Extended reading notes

Core claim

The off-diagonal Γ exchange interaction is the key interaction controlling the high-field phases of β-Li₂IrO₃. It couples the ferromagnetic (F) and staggered (G) order parameters through the term E_FG = -√2 Γ(F_a G_b + F_b G_a), and for fields in the ac-plane this coupling drives a spontaneous breaking of the mirror symmetry ΘC₂b, producing an intermediate correlated phase bounded by H⋆⋆ that is absent in all other field planes. The critical fields H⋆ and H⋆⋆ depend on J and Γ but are independent of the Kitaev coupling K at leading order.

Load-bearing premise

The identification of H⋆⋆ as a genuine thermodynamic phase boundary relies on a derivative criterion d(k/H²)/dH applied to pulsed-field data with 80 ms pulse duration and limited signal-to-noise, where the transition signature is subtle near the c-axis. The paper applies this criterion identically to experimental and calculated curves but lacks an independent experimental confirmation that the feature is a true phase transition rather than a crossover.

Editorial extensions

If this is right

  • Field-induced spin liquid behavior in Kitaev candidate materials may be generically preempted by Γ-mediated correlated phases; suppressing magnetic order is not sufficient to expose the underlying Kitaev physics when off-diagonal exchange is present.
  • The energy scale |Γ| ~ 10 meV ~ 100 K may explain the anomalous magnetic signal observed near 100 K in β-Li₂IrO₃, well above the ordering temperature T_N ≈ 38 K, as a finite-temperature precursor of the same Γ-driven correlations found in the high-field phases.
  • The independence of critical fields from K at leading order provides a thermodynamic route to extract J and Γ without fitting magnon dispersions, disentangling parameters that are difficult to separate in neutron spectroscopy.
  • The symmetry-selective appearance of intermediate phases—present only when the field preserves a symmetry that Γ can break—suggests a design principle for finding or avoiding correlated high-field states in other spin-orbit-coupled magnets by tuning field orientation relative to crystal axes.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

3 major / 7 minor

Summary. This manuscript reports a high-field magnetotropic susceptibility study of the hyperhoneycomb Kitaev material β-Li₂IrO₃, mapping the field-angle phase diagram across all three principal crystallographic planes up to 60 T. The central experimental finding is the discovery of an additional high-field phase transition (H⋆⋆) that appears exclusively for fields in the ac-plane, absent in the ab- and bc-planes. The authors provide a symmetry-based explanation: the off-diagonal Γ exchange couples ferromagnetic (F) and staggered (G) order parameters via E_FG = -√2 Γ(F_a G_b + F_b G_a), and for ac-plane fields this coupling drives a spontaneous breaking of the ΘC₂b mirror symmetry, stabilizing an intermediate correlated phase. The measured angular dependence of critical fields is quantitatively compared with classical energy minimization within the J-K-Γ model, yielding J ~ 0.5 ± 0.1 meV and Γ ~ -11.5 ± 2.5 meV, consistent with prior neutron spectroscopy values.

Significance. The paper makes a valuable contribution to the Kitaev materials field. The experimental technique (resonant torsion magnetometry in pulsed fields up to 60 T) is demanding and the data are clean. The symmetry analysis identifying why H⋆⋆ appears only in the ac-plane — via the Γ-mediated cross-coupling and the surviving ΘC₂b symmetry — is internally consistent and physically transparent. The extraction of J and Γ from analytical critical-field formulas (SM S4.3, Eqs. S15–S17) that are independent of K at leading order is a genuine strength, providing a thermodynamic route to parameter determination that complements magnon spectroscopy. The falsifiable prediction that H⋆⋆ is absent in the ab- and bc-planes is confirmed experimentally. The broader claim that off-diagonal exchange preempts field-induced spin-liquid behavior is well-supported by the data and is of general interest to the community.

major comments (3)
  1. End Matter, Fig. 6 and accompanying text: The identification of H⋆⋆ as a genuine thermodynamic phase boundary rests on the derivative criterion d(k/H²)/dH applied to pulsed-field data (80 ms pulses). The paper acknowledges that the H⋆⋆ signature is subtle near H∥c ('a small change in slope'). The criterion is applied 'identically to experimental and calculated curves,' but the theoretical framework predicts the feature (order parameter vanishing as √(H⋆⋆−H), producing a divergent slope in k), the same framework guides the extraction, and the same group developed the theory (Refs. [5–8]). This creates a moderate circularity burden. The symmetry argument for why H⋆⋆ appears only in the ac-plane does not depend on this circularity and is compelling on its own. However, the experimental identification of H⋆⋆ would be substantially strengthened by discussing whether any independent thermodyan
  2. Figure 3 caption vs. Figure 4: Figure 3c,d caption states the calculation uses (J,K,Γ) = (0.4, -18, -10) meV, while Figure 4 caption states the theoretical curves use (J,K,Γ) = (0.4, -24, -9.3) meV. These are different parameter sets. The main text (Discussion) reports extracted values J ~ 0.5 ± 0.1 meV and Γ ~ -11.5 ± 2.5 meV. It is unclear which parameter set is used for which comparison, and why the Kitaev coupling differs between the two figures. The reader cannot assess whether the quantitative agreement claimed in Figure 4 uses the same parameters as the calculated curves in Figure 3. The authors should clarify which parameters are used in each figure and reconcile the discrepancy.
  3. Discussion, parameter extraction: The extracted values J ~ 0.5 ± 0.1 meV and Γ ~ -11.5 ± 2.5 meV are obtained from the analytical formulas (Eqs. S15, S17) using measured H⋆_c ≈ 16 T and H⋆⋆_c ≈ 42 T. However, the sign of J is reported as positive in the main text but appears as negative (J = -0.4 meV) in SM Figure S5 caption and SM §S4.3. Additionally, the error bars on J and Γ are stated without derivation. Given that H⋆_b (Eq. S15) depends only on J, and H⋆_c depends on both J and Γ, the authors should clarify the sign convention, state how the error bars propagate from the experimental uncertainties on H⋆_c and H⋆⋆_c, and note whether the g-tensor anisotropy (Eq. S16) was included in the extraction. A brief statement of the extraction procedure in the main text, rather than only referencing the SM, would address this.
minor comments (7)
  1. SM §S4.1, Fig. S5 caption: The parameter set is listed as (J, K, Γ) = (-0.4, -18, -10) meV, which has J negative, whereas the main text and other SM sections use J = +0.4 meV. This should be reconciled — likely a sign convention issue that should be clarified.
  2. Fig. 2c: The dashed theoretical IC phase boundary is shown but the parameter set is not stated in the caption (it is stated in the caption of Fig. 3 as (0.4, -18, -10) meV). For consistency, the parameters should be noted, even if small.
  3. SM §S4.3, Eq. (S16): The g-tensor estimates use Curie-Weiss effective moments from Majumder et al. [17]. The assumption g_bb = 2 as a reference should be justified or flagged as an assumption that affects the extracted J and Γ.
  4. The phrase 'Eclipsing Kitaev' in the title is evocative but could be read as overclaiming. The paper shows that Γ governs the high-field phases, not that K is unimportant. Consider softening to 'off-diagonal exchange governs the correlated high-field phases of β-Li₂IrO₃' (which is already the subtitle).
  5. Introduction: The statement that 'the broader field-angle phase diagram and the nature of the high-field phases remains relatively unexplored' could cite Ref. [21] (Majumder et al., PRM 2019), which reported field-angle-dependent phase boundaries including the ac-plane.
  6. Fig. 3b: The angle labels (e.g., '87', '77', etc.) are defined as degrees from the c-axis but this is only stated in the End Matter (Fig. 6 caption). A note in the Fig. 3 caption would help the reader.
  7. SM §S4.6.3, Eq. (S50): The argument of sin and cos is written as θ_ab but should be θ_ac for the ac-plane case. This appears to be a typo.

Simulated Author's Rebuttal

3 responses · 0 unresolved

We thank the referee for a careful and constructive report. The significance assessment is appreciated, and the major comments identify genuine issues that we will address in the revised manuscript. Below we respond point by point.

read point-by-point responses
  1. Referee: End Matter, Fig. 6 and accompanying text: The identification of H⋆⋆ as a genuine thermodynamic phase boundary rests on the derivative criterion d(k/H²)/dH applied to pulsed-field data (80 ms pulses). [...] This creates a moderate circularity burden. [...] The experimental identification of H⋆⋆ would be substantially strengthened by discussing whether any independent thermodynamic [evidence supports it].

    Authors: The referee raises a valid concern about circularity. We agree that the argument would be stronger with an independent thermodynamic probe, and we will revise the manuscript to address this explicitly and honestly. revision: partial

  2. Referee: Figure 3 caption vs. Figure 4: different parameter sets (0.4,-18,-10) vs (0.4,-24,-9.3). Unclear which parameters are used where and why K differs.

    Authors: The referee is correct that the two figures use different parameter sets, and the manuscript does not adequately explain this. To clarify: Figure 3 (panels c,d) shows calculated magnetotropic susceptibility curves for direct qualitative comparison with the experimental data in panels (a,b). These use the parameter set (J,K,Γ) = (0.4, −18, −10) meV from Li et al. (Ref. [8]), which was the set used in the prior theoretical study that first predicted the torque feature we now identify as H⋆⋆. The purpose of Figure 3 is to show that the minimal J-K-Γ model reproduces the qualitative lineshape and angular evolution of k(H), not to perform a quantitative parameter fit. Figure 4, by contrast, overlays the theoretical phase boundaries on the experimental phase diagram. Here we use the refined neutron spectroscopy parameters (J,K,Γ) = (0.4, −24, −9.3) meV from Halloran et al. (Ref. [38]) because these represent the best-available independent determination, and the comparison tests whether those parameters are consistent with our thermodynamic phase boundaries. The different K values reflect the known difficulty of constraining K from magnon spectroscopy (as discussed in our manuscript), and the insensitivity of the critical fields to K (demonstrated in SM Figure S6) is precisely why this discrepancy does not affect the phase boundary comparison. The extracted values J ~ 0.5 ± 0.1 meV and Γ ~ −11.5 ± 2.5 meV reported in the Discussion constitute a third, independent determination from the analytical critical-field formulas. We will revise the figure captions and add a sentence in the main text clarifying that different figures serve different purposes (qualitative lineshape comparison vs. quantitative phase boundary overlay vs. analytical extraction) and therefore use different,, revision: yes

  3. Referee: Discussion, parameter extraction: sign of J (positive in main text, negative in SM Fig S5), error bars without derivation, g-tensor anisotropy inclusion.

    Authors: The referee has identified a genuine inconsistency that we will correct. The sign of J in the main text (J ~ 0.5 meV, positive) is correct for our convention, where positive J denotes antiferromagnetic Heisenberg exchange. The appearance of J = −0.4 meV in the SM Figure S5 and Figure S8 captions is an error: those captions should read (J,K,Γ) = (0.4, −18, −10) meV, consistent with the main text Figure 3 and with SM §S4.2. We will correct these captions. Regarding the error bars: H⋆_b depends only on J via Eq. (S15), giving J directly from the measured H⋆_b = 2.8 ± 0.3 T. The uncertainty on J propagates from the experimental uncertainty in identifying H⋆_b from the RTM data (estimated at ~10% based on the field resolution and the sharpness of the transition near H∥b). H⋆_c depends on both J and Γ via Eq. (S15), and H⋆⋆_c depends on both via Eq. (S17). With J fixed from H⋆_b, Γ is determined from the pair (H⋆_c ≈ 16 ± 1 T, H⋆⋆_c ≈ 42 ± 2 T), and the error bar on Γ reflects the combined uncertainties. The g-tensor anisotropy (Eq. S16) was included in the extraction; we used g_cc ≈ 2.1 and g_aa ≈ 2.0 as estimated from Curie-Weiss effective moments (SM §S4.3). We will add a brief paragraph in the main text summarizing the extraction procedure, including the sign convention, the propagation of uncertainties, and the g-tensor values used. revision: yes

Circularity Check

0 steps flagged · score 2.0 of 10

Minor self-citation of analytical framework by overlapping authors; no prediction reduces to inputs by construction

full rationale

The paper's central derivation chain is not circular. The key symmetry result — that the Γ exchange produces the cross-coupling term E_FG = -√2 Γ(F_a G_b + F_b G_a) (Eq. 4 / SM Eq. S12) — follows by direct algebraic rewriting of the J-K-Γ Hamiltonian (Eq. 2) in terms of the F and G order parameters. This is a legitimate derivation, not a definition. The symmetry analysis (Table I) showing that only the ac-plane admits a spontaneous ΘC₂b-breaking instability is a group-theoretic argument that does not depend on fitted parameters. The extraction of J ~ 0.5 meV and Γ ~ -11.5 meV from measured critical fields H⋆_c ≈ 16 T and H⋆⋆_c ≈ 42 T uses analytical formulas (Eqs. S15, S17) from prior work by overlapping authors (Rousochatzakis, Perkins — refs [5-8]). However, these are analytical expressions derived from the model, not fits to the present data; inverting them to obtain exchange parameters from independently measured critical fields is a standard procedure, not a circular reduction. The calculated curves in Figs. 3c,d use parameters (0.4, -18, -10) meV from Li et al. [8] and the phase boundaries in Fig. 4 use (0.4, -24, -9.3) meV from Halloran et al. [38] (neutron spectroscopy, which includes non-overlapping authors). The paper's own extracted values are cross-validated against these independent determinations, not against themselves. The H⋆⋆ identification via d(k/H²)/dH is theory-guided (the √(H⋆⋆-H) order parameter behavior predicts a divergent slope in k), but the experimental feature exists in the raw data independent of the criterion used to isolate it. The concern about whether H⋆⋆ is a genuine thermodynamic phase boundary vs. a crossover is a correctness/experimental risk, not a circularity issue. The self-citation of the theoretical framework by Rousochatzakis and Perkins is present but not load-bearing in a circular sense: the J-K-Γ model is a standard Hamiltonian used by many groups, the six-sublattice ansatz is a standard approach, and the critical field formulas are analytical results that are independently verifiable. No 'prediction' in the paper reduces to its inputs by construction.

Assumptions & free parameters 4 free parameters · 4 assumptions · 0 invented entities

No new particles, forces, or entities are postulated. The paper works entirely within the established J-K-Γ framework.

free parameters (4)
  • J (Heisenberg exchange) = 0.4 meV (from prior neutron spectroscopy [38]); 0.5 ± 0.1 meV (extracted from critical fields in this work)
    Nearest-neighbor Heisenberg exchange; fitted to neutron data in prior work and re-extracted from H⋆ and H⋆⋆ critical fields using Eqs. S15, S17
  • K (Kitaev exchange) = -18 to -24 meV (from prior work; not independently determined in this paper)
    Dominant exchange; taken from prior neutron spectroscopy [38]. Paper claims critical fields are independent of K at leading order, so K is not re-fitted here
  • Γ (off-diagonal exchange) = -9.3 to -10 meV (from prior work); -11.5 ± 2.5 meV (extracted from critical fields in this work)
    Off-diagonal exchange; fitted to neutron data in prior work and re-extracted from H⋆ and H⋆⋆ critical fields using Eqs. S15, S17
  • g-tensor components (g_aa, g_bb, g_cc, g_ab) = g_aa = g_bb = g_cc = 2, g_ab = 0.1 (from Li et al. [8]); alternatively g_cc ≈ 2.1 from Curie-Weiss fits [Majumder et al.
    Taken from prior literature; not independently measured in this work
assumptions (4)
  • domain assumption The minimal nearest-neighbor J-K-Γ Hamiltonian with anisotropic Zeeman coupling captures the magnetic physics of β-Li₂IrO₃
    Invoked throughout; the model is standard in the literature but is a minimal approximation that omits further-neighbor interactions and anisotropies
  • domain assumption Classical energy minimization of the six-sublattice ansatz correctly describes the field-induced phases at T → 0
    Used for all theoretical phase boundaries and critical field calculations (SM S4). Quantum fluctuations are neglected; validity in a Kitaev-dominated system where magnon pictures break down [2] is assumed but not independently verified
  • domain assumption The critical fields H⋆ and H⋆⋆ are independent of K at leading order
    Stated in main text and SM S4.3; this is the basis for extracting J and Γ independently of K. If K contributes at subleading order comparable to experimental uncertainties, the extracted values would shift
  • ad hoc to paper The H⋆⋆ feature identified by the d(k/H²)/dH criterion corresponds to a genuine thermodynamic phase boundary
    The criterion (End Matter, Fig 6) is applied identically to data and theory, but the experimental signature is subtle, especially near H∥c where it appears as 'a small change in slope'

how reviews work

0 comments
Cite this review

Pith. "Pith review of Eclipsing Kitaev: off-diagonal exchange governs the correlated high-field phases of $\beta$-Li$_2$IrO$_3$." pith.science (2026). https://pith.science/paper/6UPNZLGF

@misc{pith2026260706463,
  author       = {Pith},
  title        = {Pith review of: Eclipsing Kitaev: off-diagonal exchange governs the correlated high-field phases of $\beta$-Li$_2$IrO$_3$},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/6UPNZLGF}},
  note         = {Machine review of arXiv:2607.06463}
}
abstract

We report a high-field thermodynamic study of the hyperhoneycomb Kitaev material $\beta$-Li$_2$IrO$_3$, using magnetotropic susceptibility to resolve its low-temperature field-angle phase diagram across the principal crystallographic planes in magnetic fields up to $60$ T. Rather than evolving directly from the low-field incommensurate state into a polarized regime, the system exhibits a strongly direction-dependent sequence of correlated phases. Most notably, for fields in the $ac$-plane, we identify an additional high-field phase that is absent in the other principal planes and exists only within a restricted region of field-angle space. This phase structure is naturally explained by the competition between magnetic field and bond-directional exchange interactions. Using a symmetry-based description supported by microscopic calculations within the $J$-$K$-$\Gamma$ model, we show that off-diagonal $\Gamma$ exchange couples the ferromagnetic and staggered magnetic orders and thereby stabilizes the observed correlated high-field phases. The measured angular dependence of the critical fields is quantitatively captured by this theory, identifying $\Gamma$ exchange as the key interaction controlling the high-field response. These results clarify why the promise of a field-induced spin liquid -- the notion that suppressing magnetic order might reveal the underlying Kitaev physics -- remains unfulfilled in candidate materials: even when the Kitaev interaction is large, off-diagonal exchange stabilizes symmetry-constrained correlated phases that instead preempt the polarized state.

Figures

Figures reproduced from arXiv: 2607.06463 by the authors.

Figure 1
Figure 1. FIG. 1. The hyperhoneycomb structure of [PITH_FULL_IMAGE:figures/full_fig_p002_1.png] view at source ↗
Figure 2
Figure 2. FIG. 2. (a) Experimentally-determined phase diagram of [PITH_FULL_IMAGE:figures/full_fig_p003_2.png] view at source ↗
Figure 3
Figure 3. FIG. 3. Magnetotropic susceptibility for the [PITH_FULL_IMAGE:figures/full_fig_p004_3.png] view at source ↗
Figures from the paper (3 more)
Figure 4
Figure 4. Figure 4: FIG. 4. Experimental low-temperature and high-field phase diagram for [PITH_FULL_IMAGE:figures/full_fig_p005_4.png]
Figure 5
Figure 5. Figure 5: FIG. 5. Magnetotropic susceptibility divided by magnetic field squared for the [PITH_FULL_IMAGE:figures/full_fig_p009_5.png]
Figure 6
Figure 6. Figure 6: FIG. 6. Comparison of [PITH_FULL_IMAGE:figures/full_fig_p009_6.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

48 extracted references · 48 canonical work pages

  1. [1]

    Janssen, E

    L. Janssen, E. C. Andrade, and M. Vojta, Honeycomb- lattice Heisenberg-Kitaev model in a magnetic field: Spin canting, metamagnetism, and vortex crystals, Phys. Rev. Lett.117, 277202 (2016)

  2. [2]

    S. M. Winter, K. Riedl, D. Kaib, R. Coldea, and R. Va- lent´ ı, Probingα-RuCl3 beyond magnetic order: Effects of temperature and magnetic field, Phys. Rev. Lett.120, 077203 (2018)

  3. [3]

    Chern, Y

    G.-W. Chern, Y. Sizyuk, C. Price, and N. B. Perkins, Kitaev-heisenberg model in a magnetic field: Order-by- disorder and commensurate-incommensurate transitions, Phys. Rev. B95, 144427 (2017)

  4. [4]

    Janssen and M

    L. Janssen and M. Vojta, Heisenberg-Kitaev physics in magnetic fields, Journal of Physics: Condensed Matter 31, 423002 (2019)

  5. [9]

    Hermanns, I

    M. Hermanns, I. Kimchi, and J. Knolle, Physics of the Kitaev model: Fractionalization, dynamic correlations, and material connections, Annual Review of Condensed Matter Physics9, 17 (2018)

  6. [10]

    Takagi, T

    H. Takagi, T. Takayama, G. Jackeli, G. Khaliullin, and S. E. Nagler, Concept and realization of Kitaev quantum spin liquids, Nature Reviews Physics1, 264 (2019)

  7. [11]

    Trebst and C

    S. Trebst and C. Hickey, Kitaev materials, Physics Re- ports950, 1 (2022)

  8. [12]

    Rousochatzakis, N

    I. Rousochatzakis, N. B. Perkins, Q. Luo, and H.-Y. Kee, Beyond Kitaev physics in strong spin-orbit coupled mag- nets, Reports on Progress in Physics87, 026502 (2024)

Show all 48 references
  1. [13]

    A. A. Tsirlin and P. Gegenwart, Kitaev magnetism through the prism of lithium iridate, Physica Status So- lidi (B)259, 2100146 (2022)

  2. [14]

    Matsuda, T

    Y. Matsuda, T. Shibauchi, and H.-Y. Kee, Kitaev quan- tum spin liquids, Rev. Mod. Phys.97, 045003 (2025)

  3. [15]

    C. Balz, P. Lampen-Kelley, A. Banerjee, J. Yan, Z. Lu, X. Hu, S. M. Yadav, Y. Takano, Y. Liu, D. A. Tennant, M. D. Lumsden, D. Mandrus, and S. E. Nagler, Finite field regime for a quantum spin liquid inα-RuCl 3, Phys. Rev. B100, 060405(R) (2019)

  4. [19]

    S. Choi, S. Manni, J. Singleton, C. V. Topping, T. Lan- caster, S. J. Blundell, D. T. Adroja, V. Zapf, P. Gegen- wart, and R. Coldea, Spin dynamics and field-induced magnetic phase transition in the honeycomb Kitaev mag- netα-Li 2IrO3, Phys. Rev. B99, 054426 (2019)

  5. [20]

    K. A. Modic, R. D. McDonald, J. P. C. Ruff, M. D. Bachmann, Y. Lai, J. C. Palmstrom, D. Graf, M. K. Chan, F. F. Balakirev, J. B. Betts, G. S. Boebinger, M. Schmidt, M. J. Lawler, D. A. Sokolov, P. J. W. Moll, B. J. Ramshaw, and A. Shekhter, Scale-invariant mag- netic anisotrop...

  6. [21]

    Majumder, F

    M. Majumder, F. Freund, T. Dey, M. Prinz-Zwick, N. B¨ uttgen, Y. Skourski, A. Jesche, A. A. Tsirlin, and P. Gegenwart, Anisotropic temperature-field phase dia- 7 gram of single crystallineβ-Li 2IrO3: Magnetization, spe- cific heat, and 7Li NMR study, Physical Review Materials ...

  7. [22]

    Majumder, M

    M. Majumder, M. Prinz-Zwick, S. Reschke, A. Zubtsovskii, T. Dey, F. Freund, N. B¨ uttgen, A. Jesche, I. K´ ezsm´ arki, A. A. Tsirlin, and P. Gegen- wart, Field evolution of low-energy excitations in the hyperhoneycomb magnetβ-Li 2IrO3, Physical Review B 101, 214417 (2020)

  8. [23]

    Banerjee, P

    A. Banerjee, P. Lampen-Kelley, J. Knolle, C. Balz, A. A. Aczel, B. Winn, Y. Liu, D. Pajerowski, J. Yan, C. A. Bridges, A. T. Savici, B. C. Chakoumakos, M. D. Lums- den, D. A. Tennant, R. Moessner, D. G. Mandrus, and S. E. Nagler, Excitations in the field-induced quantum spin l...

  9. [24]

    Kasahara, T

    Y. Kasahara, T. Ohnishi, Y. Mizukami, O. Tanaka, S. Ma, K. Sugii, N. Kurita, H. Tanaka, J. Nasu, Y. Mo- tome, T. Shibauchi, and Y. Matsuda, Majorana quanti- zation and half-integer thermal quantum Hall effect in a Kitaev spin liquid, Nature559, 227 (2018)

  10. [25]

    J. A. N. Bruin, R. R. Claus, Y. Matsumoto, N. Kurita, H. Tanaka, and H. Takagi, Robustness of the thermal Hall effect close to half-quantization in a field-induced spin liquid state, Nature Physics18, 401 (2022)

  11. [26]

    Czajka, T

    P. Czajka, T. Gao, M. Hirschberger, P. Lampen-Kelley, A. Banerjee, J. Yan, D. G. Mandrus, S. E. Nagler, and N. P. Ong, Oscillations of the thermal conductivity in the spin-liquid state ofα-RuCl 3, Nature Physics17, 915 (2021)

  12. [27]

    Yokoi, S

    T. Yokoi, S. Ma, Y. Kasahara, S. Kasahara, T. Shibauchi, N. Kurita, H. Tanaka, J. Nasu, Y. Motome, C. Hickey, S. Trebst, and Y. Matsuda, Half-integer quantized anomalous thermal Hall effect in the Kitaev material can- didateα-RuCl 3, Science373, 568 (2021)

  13. [29]

    Biffin, R

    A. Biffin, R. D. Johnson, S. Choi, F. Freund, S. Manni, A. Bombardi, P. Manuel, P. Gegenwart, and R. Coldea, Unconventional magnetic order on the hyperhoneycomb Kitaev lattice inβ-Li 2IrO3: Full solution via magnetic resonant X-ray diffraction, Physical Review B90, 205116 (2014)

  14. [30]

    Takayama, A

    T. Takayama, A. Kato, R. Dinnebier, J. Nuss, H. Kono, L. S. I. Veiga, G. Fabbris, D. Haskel, and H. Takagi, Hy- perhoneycomb iridateβ-Li 2IrO3 as a platform for Kitaev magnetism, Physical Review Letters114, 077202 (2015)

  15. [33]

    Zambra, A

    V. Zambra, A. Nathwani, M. Nauman, S. K. Lewin, C. E. Frank, N. P. Butch, A. Shekhter, B. Ramshaw, and K. Modic, Giant transverse magnetic fluctuations at the edge of re-entrant superconductivity in UTe 2, Nature Communications17, 10.1038/s41467-026-71899- 7 (2026)

  16. [34]

    H. Gui, L. Yang, X. Wang, D. Chen, Z. Shi, J. Zhang, J. Wei, K. Zhou, W. Schnelle, Y. Zhang,et al., Prob- ing orbital magnetism of a kagome metal CsV 3Sb5 by a tuning fork resonator, Nature Communications16, 4275 (2025)

  17. [35]

    Nasir, D

    H. Nasir, D. Balazs, M. Nauman, E. Horsley, S. Kim, Y.- J. Kim, and K. Modic, Magnetic fields in monoclinicα- RuCl3 reveal rhombohedral inclusions underlying appar- ent oscillations, arXiv preprint arXiv:2605.13444 (2026)

  18. [36]

    See Supplemental Material at [URL will be inserted by publisher] for additional details on sample preparation, resonant torsion magnetometry, pulsed-field data in the bc-plane, symmetry analysis, and free energy minimiza- tion calculations, which includes Refs. [40–43]

  19. [37]

    The possibility for two intermediate phases, where the system first restores translations atH ∗ bc, then breaks ΘC2a atH ∗∗ ac , and then restores ΘC 2a atH ∗∗∗ ac is also not supported by the numerics

  20. [39]

    M. A. Vranas, A. Ruiz, V. Nagarajan, E. Lamb, G. D. Morris, Z. Islam, C. Nelson, N. Tamura, B. A. Frandsen, J. G. Analytis, and A. Frano, Anisotropic Kitaev spin glass in Li 2RuxIr1−xO3 (2026), arXiv:2601.22280 [cond- mat.str-el]

  21. [43]

    Eclipsing Kitaev: off-diagonal exchange governs the correlated high-field phases ofβ-Li 2IrO3

    K. A. Modic, T. E. Smidt, I. Kimchi, N. P. Breznay, A. Biffin, S. Choi, R. D. Johnson, R. Coldea, P. Watkins- Curry, G. T. McCandless, J. Y. Chan, F. Gandara, Z. Is- lam, A. Vishwanath, A. Shekhter, R. D. McDonald, and J. G. Analytis, Realization of a three-dimensional spin- a...

  22. [44]

    (panel b) of the Hessian matricesAandA ′, defined in (S25) and (S29), which correspond to theac- and bc-plane case, respectively. The data shown are taken at the representative anglesθ ac = 81◦ (measured from thea-axis) andθ bc = 45◦ (measured from theb-axis), for fields in th...

  23. [45]

    As shown in this graph, as we decrease the field, both eigenvalues remain positive for all field strengths, so there is no intermediate phase

    of the Hessian matrixA ′ for a representative field direction in thebcplane (θ bc =π/4). As shown in this graph, as we decrease the field, both eigenvalues remain positive for all field strengths, so there is no intermediate phase. The same is true for any other field directio...

  24. [46]

    A. Ruiz, V. Nagarajan, M. Vranas, G. Lopez, G. T. Mc- Candless, I. Kimchi, J. Y. Chan, N. P. Breznay, A. Fra˜ n´ o, B. A. Frandsen, and J. G. Analytis, High-temperature magnetic anomaly in the Kitaev hyperhoneycomb com- poundβ-Li 2IrO3, Physical Review B101, 075112 (2020)

  25. [47]

    A. Ruiz, N. P. Breznay, M. Li, I. Rousochatzakis, A. Allen, I. Zinda, V. Nagarajan, G. Lopez, Z. Islam, M. H. Upton, J. Kim, A. H. Said, X.-R. Huang, T. Gog, D. Casa, R. J. Birgeneau, J. D. Koralek, J. G. Analytis, N. B. Perkins, and A. Frano, Magnon-spinon dichotomy in the Ki...

  26. [48]

    K. A. Modic, M. D. Bachmann, B. J. Ramshaw, F. Arnold, K. R. Shirer, A. Estry, J. B. Betts, N. J. Ghimire, E. D. Bauer, M. Schmidt, M. Baenitz, E. Svanidze, R. D. McDonald, A. Shekhter, and P. J. W. Moll, Resonant torsion magnetometry in anisotropic quantum materials, Nature C...

  27. [49]

    Shekhter, R

    A. Shekhter, R. D. McDonald, B. J. Ramshaw, and K. A. Modic, Magnetotropic susceptibility, Physical Review B 108, 035111 (2023)

  28. [50]

    A. Ruiz, A. Frano, N. P. Breznay, I. Kimchi, T. Helm, I. Oswald, J. Y. Chan, R. J. Birgeneau, Z. Islam, and J. G. Analytis, Correlated states inβ-Li 2IrO3 driven by applied magnetic fields, Nature Communications8, 961 (2017)

  29. [51]

    M. Li, I. Rousochatzakis, and N. B. Perkins, Unconven- tional magnetic field response of the hyperhoneycomb Kitaev magnetβ-Li 2IrO3, Physical Review Research2, 013065 (2020)

  30. [52]

    M. Li, I. Rousochatzakis, and N. B. Perkins, Reentrant incommensurate order and anomalous magnetic torque in the Kitaev magnetβ-Li 2IrO3, Physical Review Research 2, 033328 (2020)

  31. [53]

    Takayama, A

    T. Takayama, A. Kato, R. Dinnebier, J. Nuss, H. Kono, L. S. I. Veiga, G. Fabbris, D. Haskel, and H. Takagi, Hy- perhoneycomb iridateβ−li 2iro3 as a platform for kitaev magnetism, Phys. Rev. Lett.114, 077202 (2015)

  32. [54]

    K. A. Modic, T. E. Smidt, I. Kimchi, N. P. Breznay, A. Biffin, S. Choi, R. D. Johnson, R. Coldea, P. Watkins- Curry, G. T. McCandless, J. Y. Chan, F. Gandara, Z. Is- lam, A. Vishwanath, A. Shekhter, R. D. McDonald, and J. G. Analytis, Realization of a three-dimensional spin- a...

  33. [55]

    K. A. Modic, B. J. Ramshaw, J. B. Betts, N. P. Brez- nay, J. G. Analytis, R. D. McDonald, and A. Shekhter, Robust spin correlations at high magnetic fields in the harmonic honeycomb iridates, Nature Communications 8, 180 (2017)

  34. [56]

    Riedl, Y

    K. Riedl, Y. Li, S. M. Winter, and R. Valent´ ı, Sawtooth torque in anisotropicj eff= 1/2 magnets: Application to α-RuCl3, Physical Review Letters122, 197202 (2019)

  35. [57]

    Ducatman, I

    S. Ducatman, I. Rousochatzakis, and N. B. Perkins, Mag- netic structure and excitation spectrum of the hyperhon- eycomb Kitaev magnetβ-Li 2IrO3, Physical Review B97, 125125 (2018)

  36. [58]

    Rousochatzakis and N

    I. Rousochatzakis and N. B. Perkins, Magnetic field in- duced evolution of intertwined orders in the Kitaev mag- netβ-Li 2IrO3, Physical Review B97, 174423 (2018)

  37. [59]

    E. K.-H. Lee and Y. B. Kim, Theory of magnetic phase diagrams in hyperhoneycomb and harmonic-honeycomb iridates, Physical Review B91, 064407 (2015)

  38. [60]

    E. K.-H. Lee, J. G. Rau, and Y. B. Kim, Two iridates, two models, and two approaches: a comparative study on magnetism in three-dimensional honeycomb materi- als, Physical Review B93, 184420 (2016)

  39. [61]

    Halloran, Y

    T. Halloran, Y. Wang, M. Li, I. Rousochatzakis, P. Chauhan, M. B. Stone, T. Takayama, H. Takagi, N. P. Armitage, N. B. Perkins, and C. Broholm, Magnetic ex- citations and interactions in the Kitaev hyperhoneycomb iridateβ-Li 2IrO3, Phys. Rev. B106, 064423 (2022)

  40. [62]

    Majumder, F

    M. Majumder, F. Freund, T. Dey, M. Prinz-Zwick, N. B¨ uttgen, Y. Skourski, A. Jesche, A. A. Tsirlin, and P. Gegenwart, Anisotropic temperature-field phase dia- gram of single crystallineβ-Li 2IrO3: Magnetization, spe- cific heat, and 7Li NMR study, Physical Review Materials 3,...

Pith tools

Reviewed July 8, 2026 · model on record in the stance chip above.