pith. sign in

arxiv: 1612.02027 · v1 · pith:BQNCFFUEnew · submitted 2016-11-20 · ⚛️ physics.ins-det · cond-mat.other· physics.optics

Selective sensitivity in Kerr microscopy

classification ⚛️ physics.ins-det cond-mat.otherphysics.optics
keywords contrastkerrsensitivityin-planemicroscopydemonstrateddomainimages
0
0 comments X
read the original abstract

A new technique for contrast separation in wide-field magneto-optical Kerr microscopy is introduced. Utilizing the light from eight light emitting diodes, guided to the microscope by glass fibers and being switched synchronously with the camera exposure, domain images with orthogonal in-plane sensitivity can be displayed simultaneously at real-time and images with pure in-plane or polar contrast can be obtained. The benefit of this new method of contrast separation is demonstrated for permalloy films, a NdFeB sinter magnet, and a cobalt crystal. Moreover, the new technique is shown to strongly enhance the sensitivity of Kerr microscopy by eliminating parasitic contrast contributions occurring in conventional setups. A doubling of the in-plane domain contrast and a sensitivity to Kerr rotations as low as 0.6~mdeg is demonstrated

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.