pith. sign in

arxiv: 1311.5169 · v1 · pith:J3PZ4WFCnew · submitted 2013-11-20 · 🧮 math.FA

Recovering functions from the Paley-Wiener amalgam space

classification 🧮 math.FA
keywords alphamathbbpaley-wienerspaceamalgamfamilyfunctionsclassical
0
0 comments X
read the original abstract

In this paper we show that functions from the Paley-Wiener amalgam space $(PW,l^1)=\{f\in L^2(\mathbb{R}): \sum\|\hat{f}(\xi+2\pi m) \|_{L^2([-\pi,\pi])} < \infty\}$ enjoy similar recovery properties as the classical Paley-Wiener space. Specifically, if $\{\phi_\alpha(x): \alpha\in A\}$ is a regular family of interpolators and $\{x_n: n\in \mathbb{Z}\}$ is a complete interpolating sequence for $L^2([-\pi,\pi])$, then the family $\{ e^{2\pi i m x}\phi_{\alpha}(x-x_n): m,n\in \mathbb{Z}, \alpha\in A \} $ may be used to recover $f\in(PW,l^1)$.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.