Pith. sign in

REVIEW

Perspects in astrophysical databases

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv cs/0402016 v1 pith:MDT7MEHE submitted 2004-02-09 cs.DB astro-ph

classification cs.DBastro-ph
keywords dataaccessdatasetsefficiencylargesimplicityachievedadditional
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Astrophysics has become a domain extremely rich of scientific data. Data mining tools are needed for information extraction from such large datasets. This asks for an approach to data management emphasizing the efficiency and simplicity of data access; efficiency is obtained using multidimensional access methods and simplicity is achieved by properly handling metadata. Moreover, clustering and classification techniques on large datasets pose additional requirements in terms of computation and memory scalability and interpretability of results. In this study we review some possible solutions.

Discussion (0). Continue with ORCID to comment.

Pith tools