How to Disrupt a Market

Edoardo Gallo; Federico Varese; Jonathan Lusthaus; Rebecca Heath

REVIEW 3 major objections 6 minor 296 references

How to Disrupt a Market

T0 review · 3 major / 6 minor · reviewed 2026-07-31 · grok-4.5

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read Partial delivery disruption cuts market efficiency by about 70 percent and hits sellers hardest; rating attacks do almost nothing.

desk verdict Clean lab evidence that delivery noise tanks efficiency and concentrates the market; rating noise does nothing — solid internal design, real attrition and external-validity soft spots. read the letter →

arxiv 2607.24389 v1 pith:WDGHTC2Y submitted 2026-07-27 econ.GN q-fin.EC

Edoardo Gallo , Rebecca Heath , Jonathan Lusthaus , Federico Varese This is my paper · ORCID

classification econ.GNq-fin.EC

keywords marketdisruptionillicitmarketscybercrimeasymmetricinformationreputationsystemsdeliveryattackefficiencyexperimentaleconomics

verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

Most market-design work tries to make trade more efficient. This paper asks the reverse: which interventions make a market less efficient, with an eye toward reducing the social harm of illicit online markets such as cybercrime forums. In a controlled web experiment with fixed groups of three sellers and four buyers, a 20 percent chance that a purchased good simply never arrives lowers overall efficiency by roughly 70 percent relative to an undisturbed baseline, mainly because fewer goods are sold and sellers earn far less. Randomly corrupting numerical seller ratings has no comparable effect. The same delivery shock also concentrates sales in the hands of a dominant seller, because larger sellers are less likely to have every sale fail. The authors present the result as causal evidence that delivery-side interference can shrink market activity and as a template for later field tests against real illicit markets.

What carries the argument

The delivery attack: after each purchase there is an independent 20 percent probability that the buyer receives nothing, and the buyer is not told whether the failure was caused by the attack or by the seller. The resulting private rating damage, combined with the asymmetric probability that multi-unit sellers lose every sale, is what drives both the efficiency drop and the rise in market concentration.

What would settle it

A field test that seizes or degrades a measurable fraction of deliveries on a real illicit marketplace and finds no lasting drop in transaction volume or seller earnings relative to an untreated control market would falsify the central policy claim.

Watch

Extended reading notes

Core claim

A partial disruption to delivery is an effective way to decrease market efficiency. In the final ten rounds, market efficiency in the delivery and combined treatments is respectively 70 percent and 76 percent lower than baseline; the loss is borne by sellers, whose earnings fall 63 percent and 57 percent, while the number of goods sold falls about 18 percent. Attacks that randomly replace buyer ratings leave efficiency essentially unchanged.

Load-bearing premise

That behavior in a short, low-stakes online experiment with legal goods and fixed small groups tells us how real cybercrime markets, with high stakes, anonymity tools, violence, and outside options, would respond to the same delivery shock.

Editorial extensions

If this is right

Delivery-side interventions can be used as a policy lever to shrink the gains from trade in markets one wishes to disrupt.
Rating-noise or fake-review campaigns alone are unlikely to reduce market efficiency when buyers can rely on personal trading histories.
The same delivery shock tends to create a dominant seller, giving enforcement a more visible target even as overall volume falls.
Combined delivery-plus-rating attacks add little beyond delivery attacks alone under the conditions tested.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

If personal trading relationships already substitute for public ratings, any reputation attack that leaves those private histories intact will remain weak; interventions that also scramble identity or break repeat matching may be needed.
The concentration side-effect suggests a two-stage enforcement logic: first thin the market with delivery shocks, then focus scarce investigative resources on the remaining large seller.
The 20 percent seizure rate is a design choice; mapping the dose-response curve (how efficiency and concentration change with seizure probability) would be a direct next experiment.

Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Desk Editor's Note

read the letter

The one thing worth knowing: this is a competent 2×2 MTurk market experiment that flips the usual market-design objective and shows a partial delivery disruption cuts efficiency ~70% (losses on sellers, fewer trades, rising buyer inactivity) while a rating attack does nothing. Concentration rises because complete delivery hits wipe small sellers and leave a dominant one. That causal contrast is new relative to the conceptual Slander/Sybil notes in CS/criminology and to the eBay reputation literature.

What they do well is straightforward. Between-subjects full factorial, fixed 3-seller/4-buyer groups, group-level Mann-Whitney and Wilcoxon that respect dependence, plus random-effects short-run/long-run specs that recover the same delivery effects. Adjusted efficiency nets out mechanical seizures so the volume channel is not just accounting. The complete-vs-incomplete attack split on failure-to-sell is a clean mechanism check for concentration. Citations are appropriate; no circularity in the efficiency definition.

Soft spots in proportion. The stress-test on completer-only sampling is real: they keep only groups where everyone finished (49.6% of formed groups), report no completion rates by treatment, and balance only on the survivor sample. Sellers in delivery cells earn far less and face failed deliveries; if frustrated participants time out more there, the n=14 cell medians are selected. Direction of bias is ambiguous, but with small cells it matters and should have been tabled or bounded. External validity to real cybercrime (stakes, multi-homing, violence, anonymity tech) is stated as inspiration, not tested — fair for a first lab paper, load-bearing if you want policy instruments. The 20% attack rate and last-10-round window are free parameters; results are not wildly fragile in the appendix, but they are design choices.

This is for experimental market-design people and anyone working on illicit-market disruption who wants a causal benchmark rather than another takedown anecdote. The lab claim is internally credible enough to deserve referee time; the policy framing needs tightening and the attrition margin needs reporting. I would send it to peer review, not desk-reject. Engage if you care about reputation mechanisms or cybercrime enforcement design; skip if you only want field-identified policy effects.

Referee Report

3 major / 6 minor

Summary. The paper studies how to make a market less efficient, motivated by cybercrime and other illicit markets. In a web-based experiment (oTree, MTurk), groups of seven (3 sellers, 4 buyers) trade for 20 rounds under asymmetric information about quality, with a 2×2 between-subjects design crossing a delivery attack (20% of purchases undelivered, buyers not told why) and a rating attack (20% of ratings replaced by a random rating). The main findings, estimated on the last 10 rounds using group-level Mann-Whitney tests: the delivery and combined treatments reduce market efficiency by 70% and 76% relative to baseline, with the loss borne by sellers (earnings 63%/57% lower), an ~18% reduction in goods sold, higher buyer inactivity, and increased market concentration (dominant seller's share rising to 59%/56% vs 41% baseline) driven by asymmetric reputational exposure of small vs. large sellers. The rating attack alone has no significant efficiency effect, which the authors attribute to personal trading relationships substituting for public reputation. Results are supported by random-effects robustness checks distinguishing short- and long-run effects.

Significance. If the result holds, the paper opens a genuinely new line of work: applying experimental market-design methods in reverse, to measure how markets can be made less efficient, with direct relevance to cybercrime enforcement policy where takedowns have repeatedly failed. The paper's strengths are real: a pre-structured 2×2 factorial design, conservative group-level non-parametric inference that correctly treats the market (not the individual) as the unit of independent variation, a transparent surplus-based efficiency measure with an explicit adjustment for expected seizures (Table A.2), robustness via random-effects models separating short- and long-run effects, a mechanistic analysis of the concentration result (complete vs. incomplete delivery attacks), and full instructions and design parameters in the appendices, which makes the experiment replicable. The contrast between the effective delivery attack and the ineffective rating attack — with a plausible mechanism in personal trading relationships — is informative for both theory and policy. However, the policy relevance depends on an external-validity bridge from MTurk to illicit markets that the paper asserts rather than tests,½

major comments (3)

[§B.2.1, §5.1] The headline estimates (70%/76% lower efficiency; seller earnings 63%/57% lower) are computed on '14 complete groups for each treatment,' where completeness requires all seven participants to finish the market experiment and both bonus tasks (§B.2.1). Only 49.6% of groups are complete, so half of all formed markets are discarded. The exclusion rule is plausibly endogenous to treatment: participants must click a progress bar every 30 seconds on every wait page and are forfeited after three consecutive timeouts, while sellers in Delivery/Combined earn 57–63% less and watch their goods fail to arrive — precisely the participants with the weakest incentive to remain attentive. The balance tests in Table B.7 are computed only on the completer sample and therefore cannot detect differential selection. With n=14 groups per cell, a few selected groups can move the medians on which the MW tests r
[§5, Table A.1, §A.1] The manuscript reports a large number of Mann-Whitney and Wilcoxon tests at α = 0.05 (Table A.1 alone contains dozens of starred comparisons across eight outcome variables and three round windows) with no multiple-testing correction and no pre-analysis plan referenced. Compounding this, the main-text decision to restrict treatment comparisons to the final 10 rounds 'owing to significant time trends' is a researcher degree of freedom; it is reassuring that Table A.1 shows similar effects over rounds 1–20 and that the parametric specification (Eq. 1) uses all rounds, but the headline percentages in the abstract and §5.1 are tied to the chosen window. The authors should either apply a correction (or at least state the number of hypotheses tested per family), and state whether the last-10-rounds window and the completer-only rule were pre-specified before data inspection.
[§1, §6] The abstract and §6 move from the lab result to policy for cybercrime markets ('paves the way for evidence-based... policies to disrupt cybercrime and other illicit markets'), but the external-validity step is asserted rather than examined. The experimental market differs from darknet markets on stakes, anonymity infrastructure, multi-homing, violence/exit options, and the fact that a 20% seizure rate is imposed by the experimenter rather than achievable by law enforcement. This does not undermine the internal experimental result, but the policy claim as stated does not follow from it. The discussion should delineate which features of the setting drive the result (reputational spillover from non-delivery, small group size, fixed matching) and state explicitly what would need to hold in the field for the finding to transfer.

minor comments (6)

[§5.1, Abstract] The '70% and 76% lower efficiency' figures are relative reductions from a baseline efficiency of only ~29% (Table A.1); the absolute decline is roughly 20–22 percentage points. Stating both the relative and absolute magnitudes would prevent over-reading, especially since the abstract's framing invites the relative reading.
[Table B.6] The treatment column labels are wrong: rows are labelled 'Delivery (B)', 'Rating (B)' etc., apparently copy-paste errors from the Baseline row. Also the checkmark/cross pattern should be double-checked against the text.
[§A.5, Table A.4] §A.5: the claim that firm size is not the driver is supported by the split in col. 4, but the big-seller complete-attack coefficient (2.228, SE 0.723) is estimated on what must be a small number of events (4% probability per round per big seller); report the number of complete-attack events by seller size so readers can judge the precision.
[Eqs. (2)–(3), §A.1] The notation for the latent variable is inconsistent (f* in Eq. 2 vs. α_i vs. u_i for the random effect in Eq. 3; D vs. Z vs. X for the regressors). Also 'rating attach' should read 'rating attack'.
[§5.1] Buyer earnings are described as 'unchanged across treatments,' but Table A.1 shows baseline buyer earnings falling from −6.6 to −11.7 while Combined shows a significant time trend (W, p<0.05); a sentence clarifying that the cross-treatment contrast (not the trend) is what is null would help.
[§5.2] Consider reporting the Herfindahl-Hirschman results alongside the dominant-seller share in the main text rather than only in the appendix, since the concentration claim is one of the paper's three headline findings.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: central claims are between-treatment experimental contrasts, not identities forced by definition or recycled fits.

full rationale

The paper’s load-bearing results are Mann–Whitney and Wilcoxon comparisons of group averages (and supporting random-effects / probit / conditional-logit estimates) across a 2×2 between-subjects design. Market efficiency is defined as realized surplus normalized by a transparent, a-priori maximum gains-from-trade benchmark (350 points in Baseline; expected 230 after the known 20% seizure probability for the adjusted measure). That normalization does not embed the treatment contrast: the delivery effect remains significant after the mechanical seizure adjustment, and is corroborated by independent outcomes (goods sold, buyer inactivity, seller earnings, HHI / dominant-seller share). The failure-to-sell probit uses lagged attack exposure with controls; the McFadden choice model estimates partner effects conditional on price, quality, and public ratings. None of these steps fit a parameter on the target quantity and then relabel the fit as a prediction, nor do they rest on a self-citation uniqueness theorem or ansatz. Background self-citation (Gallo et al. 2022 on noise in networks) is non-load-bearing literature context. Attrition and external-validity concerns are real but are selection/generalization issues, not circular derivation. Score 0 is therefore the correct finding.

Assumptions & free parameters 4 free parameters · 4 assumptions · 0 invented entities

The load-bearing content is empirical, not axiomatic derivation. What the claim rests on beyond standard experimental economics is a small set of design choices (market size, 20% attack rates, information structure that hides delivery attacks from buyers) and the domain premise that this stylized asymmetric-information market is a useful analogue for cybercrime platforms. No new physical entities are postulated.

free parameters (4)

delivery_attack_probability = 0.20
Hand-chosen 20% chance each purchased good is not delivered; magnitude of efficiency and concentration effects is conditional on this rate.
rating_attack_probability = 0.20
Hand-chosen 20% chance each submitted rating is replaced by a different random rating; null result is specific to this noise rate and implementation.
market_composition_and_horizon = 3 sellers / 4 buyers / 20 rounds
Fixed 3 sellers, 4 buyers, 20 rounds, production set {0,1,2} goods of one quality, costs (10/20 regular, 50/100 super) and values (30/150) chosen by experimenters; all treatment contrasts live inside this parameterization.
analysis_window_last_10_rounds = rounds 11-20
Primary reported contrasts use rounds 11–20 after observing time trends; not a fitted constant but a data-dependent analysis choice that affects headline percentages.

assumptions (4)

standard math Standard nonparametric and random-effects inference on group-level experimental outcomes identifies causal treatment effects under random assignment and the stated dependence structure.
Mann-Whitney, Wilcoxon, and RE models in §5 and Appendix A.1–A.3.
domain assumption Illicit cybercrime marketplaces are usefully approximated by a legal-goods market with quality uncertainty, identity labels, and public ratings.
Stated motivation in Introduction and §2; never validated against field cybercrime data.
ad hoc to paper Buyers are not told when non-delivery is caused by the attack, so delivery shocks also act as reputational shocks.
Design choice in §4 Treatments and Figure 1; load-bearing for the reputation-concentration mechanism.
ad hoc to paper Completer-only groups (all seven participants finish market and bonus tasks) are representative enough for treatment contrasts.
Appendix B.2.1: 49.6% of groups complete; analysis uses 14 complete groups per cell.

how reviews work

0 comments

Cite this review

Pith. "Pith review of How to Disrupt a Market." pith.science (2026). https://pith.science/paper/WDGHTC2Y

@misc{pith2026260724389,
  author       = {Pith},
  title        = {Pith review of: How to Disrupt a Market},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/WDGHTC2Y}},
  note         = {Machine review of arXiv:2607.24389}
}

read the original abstract

Market design research in economics naturally focusses on how to improve market efficiency. Our objective here is exactly the opposite - how to design interventions that make a market less efficient. Our research is inspired by the growth of illicit markets online where reducing their efficiency may reduce societal harm. Using a web-based experiment, we find that a partial disruption to delivery is an effective method to decrease market efficiency. The decrease is borne by sellers who sell fewer goods and have lower earnings. A consequence of a disruption to delivery, however, is an increase in market concentration because it facilitates the emergence of a dominant seller. In contrast, we find that attacks on seller ratings are ineffective at reducing market efficiency. This study paves the way for evidence-based, causally driven investigations to aid policies to disrupt cybercrime and other illicit markets.

Figures

Figures reproduced from arXiv: 2607.24389 by the authors.

**Figure 1.** Summary of experimental design. In the Baseline treatment, there is no disruption: the buyer receives exactly the good sent by the seller, and the seller receives exactly the rating submitted by the buyer. In the Rating treatment, the good is delivered as intended, but the rating system is disrupted - there is a 20% probability that each rating is replaced with a different, random rating. In the Delivery treatment, … view at source ↗

**Figure 2.** The effect of the interventions on market aggregates. (a) Market efficiency, sellers’ earnings and buyers’ earnings averaged over the last 10 market rounds. Bars indicate ± standard error. (b) Number of goods sold and buyer inactivity rate averaged over the last 10 market rounds. Bars indicate ± standard error. (c) The number of goods sold over the market rounds, plotted for each intervention. Lines are linear proje… view at source ↗

**Figure 3.** The change in each seller’s market share over time. (a) We plot the market share of the largest seller (blue), the intermediate seller (orange) and the smallest seller (grey) over time. Sellers are categorised according to their average market share over all market rounds. (b) We plot the frequency of submitted ratings for sellers affected by the delivery attack. We differentiate between sellers with two sales (big … view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

296 extracted references · 146 canonical work pages

[1]

2022 , month = sep, publisher =

Sherry He and Brett Hollenbeck and Davide Proserpio , title =. 2022 , month = sep, publisher =. doi:10.1287/mksc.2022.1353 , url =

arXiv 2022
[2]

1993 , publisher =

Diego Gambetta , title =. 1993 , publisher =

1993
[3]

Offline and Local: The Hidden Face of Cybercrime , volume =

Lusthaus, Jonathan and Varese, Federico , year =. Offline and Local: The Hidden Face of Cybercrime , volume =. Policing: A Journal of Policy and Practice , publisher =. doi:10.1093/police/pax042 , number =

work page doi:10.1093/police/pax042
[4]

2025 , publisher =

Peter Andreas , title =. 2025 , publisher =

2025
[5]

2025 , publisher =

Mark Galeotti , title =. 2025 , publisher =

2025
[6]

Roth, A. E. and Sonmez, T. and Unver, M. U. , year =. Kidney Exchange , volume =. The Quarterly Journal of Economics , publisher =. doi:10.1162/0033553041382157 , number =

doi:10.1162/0033553041382157
[7]

Market Design: The Policy Uses of Theory , volume =

McMillan, John , year =. Market Design: The Policy Uses of Theory , volume =. American Economic Review , publisher =. doi:10.1257/000282803321946949 , number =

work page doi:10.1257/000282803321946949
[8]

Experimental Methods: A Primer for Economists , ISBN =

Friedman, Daniel and Sunder, Shyam , year =. Experimental Methods: A Primer for Economists , ISBN =. doi:10.1017/cbo9781139174176 , publisher =

work page doi:10.1017/cbo9781139174176

Show all 296 references

[9]

Trends in the publication of experimental economics articles , volume =

Reuben, Ernesto and Li, Sherry Xin and Suetens, Sigrid and Svorenčík, Andrej and Turocy, Theodore and Kotsidis, Vasileios , year =. Trends in the publication of experimental economics articles , volume =. Journal of the Economic Science Association , publisher =. doi:10.1007/s...

doi
[10]

, year =

Allais, M. , year =. Le Comportement de l’Homme Rationnel devant le Risque: Critique des Postulats et Axiomes de l’Ecole Americaine , volume =. Econometrica , publisher =. doi:10.2307/1907921 , number =

doi
[11]

2026 , note =

All Prizes in Economic Sciences , howpublished =. 2026 , note =

2026
[12]

The Journal of Business , volume =

Fairness and the Assumptions of Economics , author =. The Journal of Business , volume =. 1986 , publisher =

1986
[13]

1952 , institution =

Some Experimental Games , author =. 1952 , institution =

1952
[14]

Prolific Participants , howpublished =
[15]

Harvard Business Review , year =

The Founder of Qualtrics on Reinventing an Already Successful Business , author =. Harvard Business Review , year =
[16]

Why CloudResearch? , howpublished =
[17]

Celebrating 11 years of Artificial, Artificial Intelligence , howpublished =
[18]

and Sarnoff, Kim and Yariv, Leeat , year =

Fréchette, Guillaume R. and Sarnoff, Kim and Yariv, Leeat , year =. Experimental Economics: Past and Future , volume =. Annual Review of Economics , publisher =. doi:10.1146/annurev-economics-081621-124424 , number =

doi
[19]

Editors’ Preface: Trends in experimental economics (1975–2018) , volume =

Nikiforakis, Nikos and Slonim, Robert , year =. Editors’ Preface: Trends in experimental economics (1975–2018) , volume =. Journal of the Economic Science Association , publisher =. doi:10.1007/s40881-019-00082-0 , number =

1975 doi
[20]

Ngai and Pengkun Wu and Chong Wu , title =

Yuanyuan Wu and Eric W.T. Ngai and Pengkun Wu and Chong Wu , title =. 2020 , month = may, publisher =. doi:10.1016/j.dss.2020.113280 , url =

2020
[21]

The Journal of Industrial Economics , volume =

CABRAL, LUÍS and HORTAÇSU, ALI , title =. The Journal of Industrial Economics , volume =. doi:https://doi.org/10.1111/j.1467-6451.2010.00405.x , url =. https://onlinelibrary.wiley.com/doi/pdf/10.1111/j.1467-6451.2010.00405.x , abstract =

2010
[22]

2016 , month = oct, publisher =

Steven Tadelis , title =. 2016 , month = oct, publisher =. doi:10.1146/annurev-economics-080315-015325 , url =

2016 doi
[23]

2006 , month = jun, publisher =

Paul Resnick and Richard Zeckhauser and John Swanson and Kate Lockwood , title =. 2006 , month = jun, publisher =. doi:10.1007/s10683-006-4309-2 , url =

2006 doi
[24]

Byers , title =

Georgios Zervas and Davide Proserpio and John W. Byers , title =. 2020 , month = nov, publisher =. doi:10.1007/s11002-020-09546-4 , url =

2020 doi
[25]

, year =

Keser, C. , year =. Experimental games for the design of reputation management systems , volume =. IBM Systems Journal , publisher =. doi:10.1147/sj.423.0498 , number =

doi
[26]

The value of bad ratings: An experiment on the impact of distortions in reputation systems , journal =

Claudia Keser and Maximilian Sp\". The value of bad ratings: An experiment on the impact of distortions in reputation systems , journal =. 2021 , month = dec, publisher =. doi:10.1016/j.socec.2021.101782 , url =

2021
[27]

Seeing Stars: How the Binary Bias Distorts the Interpretation of Customer Ratings , volume =

Fisher, Matthew and Newman, George E and Dhar, Ravi , editor =. Seeing Stars: How the Binary Bias Distorts the Interpretation of Customer Ratings , volume =. Journal of Consumer Research , publisher =. 2018 , month = mar, pages =. doi:10.1093/jcr/ucy017 , number =

2018 doi
[28]

2013 , month = feb, publisher =

Gary Bolton and Ben Greiner and Axel Ockenfels , title =. 2013 , month = feb, publisher =. doi:10.1287/mnsc.1120.1609 , url =

2013
[29]

Starting Your Retirement Benefits Early , year = 2025, url =

2025
[30]

and Katok, Elena and Ockenfels, Axel , year =

Bolton, Gary E. and Katok, Elena and Ockenfels, Axel , year =. How Effective Are Electronic Reputation Mechanisms? An Experimental Investigation , volume =. Management Science , publisher =. doi:10.1287/mnsc.1030.0199 , number =
[31]

List , title =

John A. List , title =. 2006 , month = feb, publisher =. doi:10.1086/498587 , url =

2006 doi
[32]

Wilson and Arthur Zillante , title =

Bart J. Wilson and Arthur Zillante , title =. 2010 , month = feb, publisher =. doi:10.1007/s11151-010-9240-1 , url =

2010 doi
[33]

Meet the lemons: An experiment on how cheap-talk overcomes adverse selection in decentralized markets , volume =

Siegenthaler, Simon , year =. Meet the lemons: An experiment on how cheap-talk overcomes adverse selection in decentralized markets , volume =. doi:10.1016/j.geb.2016.11.001 , journal =

2016 doi
[34]

Cybercrime and shifts in opportunities during

David Buil-Gil and Fernando Mir. Cybercrime and shifts in opportunities during. 2020 , month = aug, publisher =. doi:10.1080/14616696.2020.1804973 , url =

2020
[35]

Empty Streets, Busy Internet: A Time-Series Analysis of Cybercrime and Fraud Trends During

Steven Kemp and David Buil-Gil and Asier Moneva and Fernando Mir. Empty Streets, Busy Internet: A Time-Series Analysis of Cybercrime and Fraud Trends During. 2021 , month = jul, publisher =. doi:10.1177/10439862211027986 , url =

2021 doi
[36]

Pyrooz and Scott H

David C. Pyrooz and Scott H. Decker and Richard K. Moule , title =. 2013 , month = mar, publisher =. doi:10.1080/07418825.2013.778326 , url =

2013
[37]

Payne , title =

Brian K. Payne , title =. 2020 , month = jun, publisher =. doi:10.1007/s12103-020-09532-6 , url =

2020 doi
[39]

Alice Hutchings and Richard Clayton and Ross Anderson , title =. 2016. 2016 , month = jun, publisher =. doi:10.1109/ecrime.2016.7487947 , url =

2016
[40]

Operation Onymous , howpublished =

Europol. Operation Onymous , howpublished =
[41]

Cerys Bradley and Gianluca Stringhini , title =. 2019. 2019 , month = jun, publisher =. doi:10.1109/eurospw.2019.00057 , url =

2019
[42]

Criminal Marketplace Disrupted in International Cyber Operation , howpublished =

Office of Public Affairs , year =. Criminal Marketplace Disrupted in International Cyber Operation , howpublished =
[43]

The closure of the Silk Road: what has this meant for online drug trading? , journal =

Joe. The closure of the Silk Road: what has this meant for online drug trading? , journal =. 2014 , month = jan, publisher =. doi:10.1111/add.12422 , url =

2014 doi
[44]

D. D. Do police crackdowns disrupt drug cryptomarkets? A longitudinal analysis of the effects of Operation Onymous , journal =. 2016 , month = oct, publisher =. doi:10.1007/s10611-016-9644-4 , url =

2016 doi
[45]

2007 , pages =

An Inquiry into the Nature and Causes of the Wealth of Internet Miscreants , author =. 2007 , pages =

2007
[46]

Holt , title =

Alice Hutchings and Thomas J. Holt , title =. 2014 , month = dec, publisher =. doi:10.1093/bjc/azu106 , url =

2014 doi
[47]

Akerlof , title =

George A. Akerlof , title =. 1970 , month = aug, publisher =. doi:10.2307/1879431 , url =

1970 doi
[48]

2013 , month = dec, publisher =

Michael Yip and Craig Webber and Nigel Shadbolt , title =. 2013 , month = dec, publisher =. doi:10.1080/10439463.2013.780227 , url =

2013
[49]

2009 , url =

Herley, Cormac and Florencio, Dinei , title =. 2009 , url =

2009
[50]

The Economics of the Internet and E-commerce , year =

Paul Resnick and Richard Zeckhauser , title =. The Economics of the Internet and E-commerce , year =. doi:10.1016/s0278-0984(02)11030-3 , url =

doi
[51]

2003 , month = mar, publisher =

Mikhail I Melnik and James Alm , title =. 2003 , month = mar, publisher =. doi:10.1111/1467-6451.00180 , url =

2003
[52]

2006 , month = jun, publisher =

Daniel Houser and John Wooders , title =. 2006 , month = jun, publisher =. doi:10.1111/j.1530-9134.2006.00103.x , url =

2006
[53]

1983 , month = nov, publisher =

Carl Shapiro , title =. 1983 , month = nov, publisher =. doi:10.2307/1881782 , url =

1983 doi
[54]

Leffler , journal =

Benjamin Klein and Keith B. Leffler , journal =. The Role of Market Forces in Assuring Contractual Performance , urldate =
[55]

1982 , month = aug, publisher =

David M Kreps and Robert Wilson , title =. 1982 , month = aug, publisher =. doi:10.1016/0022-0531(82)90030-8 , url =

1982 doi
[56]

1982 , month = aug, publisher =

Paul Milgrom and John Roberts , title =. 1982 , month = aug, publisher =. doi:10.1016/0022-0531(82)90031-x , url =

1982 doi
[57]

de Figueiredo , title =

Daniel Klerman and Miguel F.P. de Figueiredo , title =. 2021 , month = mar, publisher =. doi:10.1016/j.irle.2020.105965 , url =

2021
[58]

Classroom Games: A Market for Lemons , volume =

Holt, Charles A and Sherman, Roger , year =. Classroom Games: A Market for Lemons , volume =. Journal of Economic Perspectives , publisher =. doi:10.1257/jep.13.1.205 , number =

doi
[59]

ADVERTISING AND PRODUCT QUALITY IN POSTED‐OFFER EXPERIMENTS , volume =

Holt, CHARLES and Sherman, ROGER , year =. ADVERTISING AND PRODUCT QUALITY IN POSTED‐OFFER EXPERIMENTS , volume =. Economic Inquiry , publisher =. doi:10.1111/j.1465-7295.1990.tb00802.x , number =

1990
[60]

Less Rationality, More Efficiency: A Laboratory Experiment on Lemons Markets , ISSN =

Kirstein, Roland and Kirstein, Annette , year =. Less Rationality, More Efficiency: A Laboratory Experiment on Lemons Markets , ISSN =. doi:10.2139/ssrn.964633 , journal =

doi
[61]

Privacy concerns, voluntary disclosure of information, and unraveling: An experiment , volume =

Benndorf, Volker and K\". Privacy concerns, voluntary disclosure of information, and unraveling: An experiment , volume =. 2015 , month = apr, pages =. doi:10.1016/j.euroecorev.2015.01.005 , journal =

2015 doi
[62]

and Plott, Charles R

Miller, Ross M. and Plott, Charles R. , year =. Product Quality Signaling in Experimental Markets , volume =. Econometrica , publisher =. doi:10.2307/1912657 , number =

doi
[63]

Miller and Charles R

Michael Lynch and Ross M. Miller and Charles R. Plott and Russell Porter , title =. 1986 , booktitle =

1986
[64]

Cason and Lata Gangadharan , title =

Timothy N. Cason and Lata Gangadharan , title =. 2002 , month = jan, publisher =. doi:10.1006/jeem.2000.1170 , url =

2002
[65]

Pillars of Trust: An Experimental Study on Reputation and Its Effects , volume =

Boero, Riccardo and Bravo, Giangiacomo and Castellani, Marco and Laganà, Francesco and Squazzoni, Flaminio , year =. Pillars of Trust: An Experimental Study on Reputation and Its Effects , volume =. Sociological Research Online , publisher =. doi:10.5153/sro.2042 , number =

doi
[66]

Experimental Tests of a Sequential Equilibrium Reputation Model , volume =

Camerer, Colin and Weigelt, Keith , year =. Experimental Tests of a Sequential Equilibrium Reputation Model , volume =. Econometrica , publisher =. doi:10.2307/1911840 , number =

doi
[67]

Ipeirotis , title =

Gabriele Paolacci and Jesse Chandler and Panagiotis G. Ipeirotis , title =. 2010 , month = aug, publisher =. doi:10.1017/s1930297500002205 , url =

2010 doi
[68]

2011 , month = jun, publisher =

Winter Mason and Siddharth Suri , title =. 2011 , month = jun, publisher =. doi:10.3758/s13428-011-0124-6 , url =

2011 doi
[69]

Social preferences in the online laboratory: a randomized experiment , volume =

Hergueux, Jér\^ome and Jacquemet, Nicolas , year =. Social preferences in the online laboratory: a randomized experiment , volume =. Experimental Economics , publisher =. doi:10.1007/s10683-014-9400-5 , number =

doi
[70]

Lab vs online experiments: No differences , volume =

Prissé, Benjamin and Jorrat, Diego , year =. Lab vs online experiments: No differences , volume =. doi:10.1016/j.socec.2022.101910 , journal =

2022
[71]

Lab-like findings from online experiments , volume =

Buso, Irene Maria and Di Cagno, Daniela and Ferrari, Lorenzo and Larocca, Vittorio and Lorè, Luisa and Marazzi, Francesca and Panaccione, Luca and Spadoni, Lorenzo , year =. Lab-like findings from online experiments , volume =. Journal of the Economic Science Association , pub...

doi
[73]

Moss and Leib Litman , editor =

Jonathan Robinson and Cheskie Rosenzweig and Aaron J. Moss and Leib Litman , editor =. Tapped out or barely tapped? Recommendations for how to harness the vast and largely unused potential of the Mechanical Turk participant pool , journal =. 2019 , month = dec, publisher =. do...

2019 doi
[74]

(Savikhin) Samak , title =

Anya C. (Savikhin) Samak , title =. 2013 , month = jan, publisher =. doi:10.1016/j.dss.2012.10.039 , url =

2013 doi
[75]

2023 , CONTACT =

Cyber security breaches survey , INSTITUTION =. 2023 , CONTACT =

2023
[76]

Internet Crime Report , INSTITUTION =
[77]

Internet organised crime threat assessment , author =
[78]

Massive blow to criminal Dark Web activities after globally coordinated operation , author =
[79]

We Know Where You Are, What You Are Doing and We Will Catch You , volume =

Ladegaard, Isak , year =. We Know Where You Are, What You Are Doing and We Will Catch You , volume =. The British Journal of Criminology , publisher =. doi:10.1093/bjc/azx021 , number =

doi
[80]

International Journal of Cyber Criminology , year =

Roderic Broadhurst and Peter Grabosky and Mamoun Alazab and Steve Chon , title =. International Journal of Cyber Criminology , year =
[81]

2022 , month = feb, publisher =

Jonathan Lusthaus and Jaap van Oss and Philipp Amann , title =. 2022 , month = feb, publisher =. doi:10.1177/14773708221077615 , url =

2022 doi
[82]

Holt and Eric Lampke , title =

Thomas J. Holt and Eric Lampke , title =. 2010 , month = mar, publisher =. doi:10.1080/14786011003634415 , url =

2010 doi
[83]

2017 , month = oct, publisher =

Rutger Leukfeldt and Edward Kleemans and Wouter Stol , title =. 2017 , month = oct, publisher =. doi:10.1177/0002764217734267 , url =

2017 doi
[84]

2018 , isbn =

Jonathan Lusthaus , title =. 2018 , isbn =

2018
[85]

Reputation in a dark network of online criminals , journal =

David D. Reputation in a dark network of online criminals , journal =. 2013 , month = may, publisher =. doi:10.1080/17440572.2013.801015 , url =

2013
[86]

The ecology of trust among hackers , journal =

Benoit Dupont and Anne-Marie Cote and Claire Savine and David D. The ecology of trust among hackers , journal =. 2016 , month = mar, publisher =. doi:10.1080/17440572.2016.1157480 , url =

2016
[87]

Rand and Anna Dreber , journal =

Drew Fudenberg and David G. Rand and Anna Dreber , journal =. Slow to Anger and Fast to Forgive: Cooperation in an Uncertain World , urldate =
[88]

Riyanto and Nilanjan Roy and Tat-How Teh , title =

Edoardo Gallo and Yohanes E. Riyanto and Nilanjan Roy and Tat-How Teh , title =. 2022 , month = jul, publisher =. doi:10.1016/j.geb.2022.03.015 , url =

2022 doi
[89]

1995 , month = jul, publisher =

Joyce Berg and John Dickhaut and Kevin McCabe , title =. 1995 , month = jul, publisher =. doi:10.1006/game.1995.1027 , url =

1995
[90]

2013 , month = jul, publisher =

Paolo Crosetto and Antonio Filippin , title =. 2013 , month = jul, publisher =. doi:10.1007/s11166-013-9170-z , url =

2013 doi
[91]

Chen and Martin Schonger and Chris Wickens , title =

Daniel L. Chen and Martin Schonger and Chris Wickens , title =. 2016 , month = mar, publisher =. doi:10.1016/j.jbef.2015.12.001 , url =

2016 doi
[92]

2013 , month = dec, publisher =

Eyal Peer and Joachim Vosgerau and Alessandro Acquisti , title =. 2013 , month = dec, publisher =. doi:10.3758/s13428-013-0434-y , url =

2013 doi
[93]

Rand and Ya

Ofra Amir and David G. Rand and Ya. Economic Games on the Internet: The Effect of \ 1 Stakes , journal =. 2012 , month = feb, publisher =. doi:10.1371/journal.pone.0031461 , url =

2012 doi
[94]

2012 , month = may, publisher =

Jonathan Lusthaus , title =. 2012 , month = may, publisher =. doi:10.1080/17440572.2012.674183 , url =

2012
[95]

2007 , month = nov, publisher =

Paul J Healy , title =. 2007 , month = nov, publisher =. doi:10.1257/aer.97.5.1751 , url =

2007 doi
[96]

R. L. Prentice and L. A. Gloeckler , title =. 1978 , month = mar, publisher =. doi:10.2307/2529588 , url =

1978 doi
[97]

2006 , abstract =

HSHAZ: Stata module to estimate discrete time (grouped data) proportional hazards models , author =. 2006 , abstract =

2006
[98]

Arechar and Simon G\"

Antonio A. Arechar and Simon G\". Conducting interactive experiments online , journal =. 2017 , month = may, publisher =. doi:10.1007/s10683-017-9527-2 , url =

2017 doi
[99]

2015 , booktitle =

Framing Dependencies Introduced by Underground Commoditization , author =. 2015 , booktitle =

2015
[100]

Fitting stratified proportional odds models by amalgamating conditional likelihoods

Mukherjee, B., and Ahn, J., and Liu, I., and Rathouz, P., and Sánchez, B. Fitting stratified proportional odds models by amalgamating conditional likelihoods. Stat Med. 2008

2008
[101]

feologit: A new command for fitting fixed-effects ordered logit models

Baetschmann, G., and Ballantyne, A., and Staub, K.E., and Winkelmann, R. feologit: A new command for fitting fixed-effects ordered logit models. The STATA journal. 2020

2020
[102]

Consistent estimation of the fixed effects ordered logit model

Baetschmann, G., and Staub, K.E., and Winkelmann, R. Consistent estimation of the fixed effects ordered logit model. Journal of the Royal Statistical Society. Series A (Statistics in Society). 2015

2015
[103]

Mann, H. B. and Whitney, D. R. , year =. On a Test of Whether one of Two Random Variables is Stochastically Larger than the Other , volume =. The Annals of Mathematical Statistics , publisher =. doi:10.1214/aoms/1177730491 , number =
[104]

Individual Comparisons by Ranking Methods , volume =

Wilcoxon, Frank , year =. Individual Comparisons by Ranking Methods , volume =. Biometrics Bulletin , publisher =. doi:10.2307/3001968 , number =

doi
[105]

Conditional logit analysis of qualitative choice behavior , year =

McFadden, Daniel , booktitle =. Conditional logit analysis of qualitative choice behavior , year =
[106]

Internet Crime Report , year =
[107]

, year =

Motoyama, Marti and McCoy, Damon and Levchenko, Kirill and Savage, Stefan and Voelker, Geoffrey M. , year =. An analysis of underground forums , url =. doi:10.1145/2068816.2068824 , booktitle =
[108]

Traveling the silk road: a measurement analysis of a large anonymous online marketplace , url =

Christin, Nicolas , year =. Traveling the silk road: a measurement analysis of a large anonymous online marketplace , url =. doi:10.1145/2488388.2488408 , booktitle =
[109]

the Most Dangerous Cybercrime Forum in the World

Dupont, Benoît and C\^oté, Anne-Marie and Boutin, Jean-Ian and Fernandez, José , year =. Darkode: Recruitment Patterns and Transactional Features of “the Most Dangerous Cybercrime Forum in the World” , volume =. American Behavioral Scientist , publisher =. doi:10.1177/00027642...

doi
[110]

Market design , ISBN =

Agarwal, Nikhil and Budish, Eric , year =. Market design , ISBN =. doi:10.1016/bs.hesind.2021.11.010 , booktitle =

2021 doi
[111]

and Shadbolt, Nigel R

Huynh, Trung Dong and Jennings, Nicholas R. and Shadbolt, Nigel R. , year =. Certified reputation: how an agent can trust a stranger , url =. doi:10.1145/1160633.1160854 , booktitle =
[112]

To Catch a Hacker: Toward a comprehensive strategy to identify, pursue and punish malicious cyber actors , year =

Eoyang, Mieke and Peters, Allison and Mehta, Ishan and Gaskew, Brandon , institution =. To Catch a Hacker: Toward a comprehensive strategy to identify, pursue and punish malicious cyber actors , year =
[113]

Justice Department Announces Arrest of the Founder of One of the World's Largest Hacker Forums and Disruption of Forum's Operation , year =

Office of Public Affairs , institution =. Justice Department Announces Arrest of the Founder of One of the World's Largest Hacker Forums and Disruption of Forum's Operation , year =
[114]

2025 , url =

NCSC Annual Review 2025 , institution =. 2025 , url =

2025
[115]

2025 , month = oct, day =

McMahon, Liv and Jamali, Lily , title =. 2025 , month = oct, day =

2025
[116]

The Guardian , year =

Taylor, Josh , title =. The Guardian , year =
[117]

Datum Insights Blog , date =

Downtime: what it costs. Datum Insights Blog , date =
[118]

2021 , url =

Kaye, Jeremy and Muro, Mitch and Megas, Katerina , title =. 2021 , url =

2021
[119]

2026 , month = jan, day =

Cerullo, Megan , title =. 2026 , month = jan, day =

2026
[120]

The Guardian , year =

Lavelle, Daniel , title =. The Guardian , year =
[121]

Digital 2025 Global Overview Report , year =

2025
[122]

2024 , month = apr, day =

From WhatsApp to Greggs – why is tech going down more? , howpublished =. 2024 , month = apr, day =

2024
[123]

and Ozer, Murat and Li, Chengcheng and Abdo, Jacques Bou , journal=

Falowo, Olufunsho I. and Ozer, Murat and Li, Chengcheng and Abdo, Jacques Bou , journal=. Evolving Malware and DDoS Attacks: Decadal Longitudinal Study , year=
[124]

2025 , month =

Charlotte Edwards , title =. 2025 , month =

2025
[125]

2025 , month =

Phil Upton and Andrew Dawkins , title =. 2025 , month =

2025
[126]

Cheap Talk, Fraud, and Adverse Selection in Financial Markets: Some Experimental Evidence , volume =

Forsythe, Robert and Lundholm, Russell and Rietz, Thomas , year =. Cheap Talk, Fraud, and Adverse Selection in Financial Markets: Some Experimental Evidence , volume =. Review of Financial Studies , publisher =. doi:10.1093/revfin/12.3.0481 , number =

doi
[127]

and Fréchette, Guillaume R

Aoyagi, Masaki and Bhaskar, V. and Fréchette, Guillaume R. , year =. The Impact of Monitoring in Infinitely Repeated Games: Perfect, Public, and Private , volume =. American Economic Journal: Microeconomics , publisher =. doi:10.1257/mic.20160304 , number =

doi
[128]

The American Economic Review , volume =

Network Externalities, Competition, and Compatibility , author =. The American Economic Review , volume =. 1985 , publisher =

1985
[129]

Standardization, Compatibility, and Innovation , volume =

Farrell, Joseph and Saloner, Garth , year =. Standardization, Compatibility, and Innovation , volume =. The RAND Journal of Economics , publisher =. doi:10.2307/2555589 , number =

doi
[130]

The American Economic Review , volume =

Installed Base and Compatibility: Innovation, Product Preannouncements, and Predation , author =. The American Economic Review , volume =. 1986 , publisher =

1986
[131]

The Economic Journal , volume =

Competing Technologies, Increasing Returns, and Lock-In by Historical Events , author =. The Economic Journal , volume =. 1989 , publisher =

1989
[132]

Lock‐In Effects in Online Labor Markets , ISSN =

Ciotti, Fabrizio and Hornuf, Lars and Stenzhorn, Eliza , year =. Lock‐In Effects in Online Labor Markets , ISSN =. doi:10.1111/jems.12612 , journal =

doi
[133]

The Good News-Bad News Effect: Asymmetric Processing of Objective Information about Yourself , volume =

Eil, David and Rao, Justin M , year =. The Good News-Bad News Effect: Asymmetric Processing of Objective Information about Yourself , volume =. American Economic Journal: Microeconomics , publisher =. doi:10.1257/mic.3.2.114 , number =

doi
[134]

Motivated False Memory , volume =

Chew, Soo Hong and Huang, Wei and Zhao, Xiaojian , year =. Motivated False Memory , volume =. Journal of Political Economy , publisher =. doi:10.1086/709971 , number =

doi
[135]

Strong Evidence for Gender Differences in Risk Taking , volume =

Charness, Gary and Gneezy, Uri , year =. Strong Evidence for Gender Differences in Risk Taking , volume =. Journal of Economic Behavior & Organization , publisher =. doi:10.1016/j.jebo.2011.06.007 , number =

2011 doi
[136]

Dictator games: a meta study , volume =

Engel, Christoph , year =. Dictator games: a meta study , volume =. Experimental Economics , publisher =. doi:10.1007/s10683-011-9283-7 , number =

doi
[137]

Gender differences in dictator giving: A high-power laboratory test , volume =

Barreda-Tarrazona, Iván and Jaramillo-Gutiérrez, Ainhoa and Pavan, Marina and Sabater-Grande, Gerardo , editor =. Gender differences in dictator giving: A high-power laboratory test , volume =. PLOS ONE , publisher =. 2025 , month = feb, pages =. doi:10.1371/journal.pone.03178...

2025 doi
[138]

Gender differences in altruism on Mechanical Turk: Expectations and actual behaviour , volume =

Brañas-Garza, Pablo and Capraro, Valerio and Rascón-Ramírez, Ericka , year =. Gender differences in altruism on Mechanical Turk: Expectations and actual behaviour , volume =. doi:10.1016/j.econlet.2018.05.022 , journal =

2018 doi
[139]

American Economic Review , volume=

The dynamics of motivated beliefs , author=. American Economic Review , volume=
[140]

2017 , month = jul, day =

Massive blow to criminal Dark-Web activities after globally coordinated operation , howpublished =. 2017 , month = jul, day =

2017
[141]

Scandinavian Journal of Statistics , volume =

Sture Holm , title =. Scandinavian Journal of Statistics , volume =. 1979 , publisher =

1979
[142]

and Vesterlund, Lise and Weingart, Laurie , year =

Babcock, Linda and Recalde, Maria P. and Vesterlund, Lise and Weingart, Laurie , year =. Gender Differences in Accepting and Receiving Requests for Tasks with Low Promotability , volume =. American Economic Review , publisher =. doi:10.1257/aer.20141734 , number =

doi
[143]

Leadership selection: Can changing the default break the glass ceiling? , volume =

Erkal, Nisvan and Gangadharan, Lata and Xiao, Erte , year =. Leadership selection: Can changing the default break the glass ceiling? , volume =. The Leadership Quarterly , publisher =. doi:10.1016/j.leaqua.2021.101563 , number =

2021
[144]

and Krishna, Aradhna , year =

Brown, Christina L. and Krishna, Aradhna , year =. The Skeptical Shopper: A Metacognitive Account for the Effects of Default Options on Choice , volume =. Journal of Consumer Research , publisher =. doi:10.1086/425087 , number =

doi
[145]

2002 , month = feb, pages =

The Quarterly Journal of Economics , publisher =. 2002 , month = feb, pages =. doi:10.1162/003355302753399535 , number =

2002 doi
[146]

and Benartzi, Shlomo , year =

Thaler, Richard H. and Benartzi, Shlomo , year =. Save More Tomorrow™: Using Behavioral Economics to Increase Employee Saving , volume =. Journal of Political Economy , publisher =. doi:10.1086/380085 , number =

doi
[147]

Increasing organ donation via changes in the default choice or allocation rule , volume =

Li, Danyang and Hawley, Zackary and Schnier, Kurt , year =. Increasing organ donation via changes in the default choice or allocation rule , volume =. Journal of Health Economics , publisher =. doi:10.1016/j.jhealeco.2013.09.007 , number =

2013 doi
[148]

and Huffman, David B

Bronchetti, Erin Todd and Dee, Thomas S. and Huffman, David B. and Magenheim, Ellen , year =. WHEN A NUDGE ISN’T ENOUGH: DEFAULTS AND SAVING AMONG LOW-INCOME TAX FILERS , volume =. National Tax Journal , publisher =. doi:10.17310/ntj.2013.3.04 , number =

2013 doi
[149]

and Eagly, Alice H

Koenig, Anne M. and Eagly, Alice H. and Mitchell, Abigail A. and Ristikari, Tiina , year =. Are leader stereotypes masculine? A meta-analysis of three research paradigms. , volume =. Psychological Bulletin , publisher =. doi:10.1037/a0023557 , number =

doi
[150]

and Padgitt, Kail and Peart, Sandra J

Levy, David M. and Padgitt, Kail and Peart, Sandra J. and Houser, Daniel and Xiao, Erte , year =. Leadership, cheap talk and really cheap talk , volume =. Journal of Economic Behavior & Organization , publisher =. doi:10.1016/j.jebo.2010.02.018 , number =

2010 doi
[151]

Fernanda and Sutter, Matthias , year =

Rivas, M. Fernanda and Sutter, Matthias , year =. The benefits of voluntary leadership in experimental public goods games , volume =. Economics Letters , publisher =. doi:10.1016/j.econlet.2011.04.007 , number =

2011 doi
[152]

Endogenous Leadership: Selection and Influence , ISSN =

Arbak, Emrah and Villeval, Marie Claire , year =. Endogenous Leadership: Selection and Influence , ISSN =. doi:10.2139/ssrn.982143 , journal =

doi
[153]

Voluntary leadership: motivation and influence , volume =

Arbak, Emrah and Villeval, Marie-Claire , year =. Voluntary leadership: motivation and influence , volume =. Social Choice and Welfare , publisher =. doi:10.1007/s00355-011-0626-2 , number =

doi
[154]

Voluntary leadership in an experimental trust game , volume =

Kleine, Fabian and K\". Voluntary leadership in an experimental trust game , volume =. 2014 , month = dec, pages =. doi:10.1016/j.jebo.2014.02.008 , journal =

2014 doi
[155]

, year =

Ertac, Seda and Gurdal, Mehmet Y. , year =. Deciding to decide: Gender, leadership and risk-taking in groups , volume =. Journal of Economic Behavior & Organization , publisher =. doi:10.1016/j.jebo.2011.06.009 , number =

2011 doi
[156]

Who are the voluntary leaders? Experimental evidence from a sequential contribution game , volume =

Préget, Raphaële and Nguyen-Van, Phu and Willinger, Marc , year =. Who are the voluntary leaders? Experimental evidence from a sequential contribution game , volume =. Theory and Decision , publisher =. doi:10.1007/s11238-016-9550-3 , number =

doi
[157]

Inside the Turk: Understanding Mechanical Turk as a Participant Pool , volume =

Paolacci, Gabriele and Chandler, Jesse , year =. Inside the Turk: Understanding Mechanical Turk as a Participant Pool , volume =. Current Directions in Psychological Science , publisher =. doi:10.1177/0963721414531598 , number =

doi
[158]

Understanding Gender Differences in Leadership , volume =

Alan, Sule and Ertac, Seda and Kubilay, Elif and Loranth, Gyongyi , year =. Understanding Gender Differences in Leadership , volume =. The Economic Journal , publisher =. doi:10.1093/ej/uez050 , number =

doi
[159]

On becoming a woman leader

Madsen, Susan R. On becoming a woman leader
[160]

The Intrinsic Value of Decision Rights: Intrinsic Value of Decision Rights , volume =

Bartling, Bj\". The Intrinsic Value of Decision Rights: Intrinsic Value of Decision Rights , volume =. Econometrica , publisher =. 2014 , month = nov, pages =. doi:10.3982/ecta11573 , number =

2014 doi
[161]

Flory, J. A. and Leibbrandt, A. and List, J. A. , year =. Do Competitive Workplaces Deter Female Workers? A Large-Scale Natural Field Experiment on Job Entry Decisions , volume =. The Review of Economic Studies , publisher =. doi:10.1093/restud/rdu030 , number =

doi
[162]

and Niederle, M

Gneezy, U. and Niederle, M. and Rustichini, A. , year =. Performance in Competitive Environments: Gender Differences , volume =. The Quarterly Journal of Economics , publisher =. doi:10.1162/00335530360698496 , number =

doi
[163]

and Vesterlund, L

Niederle, M. and Vesterlund, L. , year =. Do Women Shy Away From Competition? Do Men Compete Too Much? , volume =. The Quarterly Journal of Economics , publisher =. doi:10.1162/qjec.122.3.1067 , number =

doi
[164]

Gender Differences in Preferences , volume =

Croson, Rachel and Gneezy, Uri , year =. Gender Differences in Preferences , volume =. Journal of Economic Literature , publisher =. doi:10.1257/jel.47.2.448 , number =

doi
[165]

Gender, Competitiveness, and Career Choices * , volume =

Buser, Thomas and Niederle, Muriel and Oosterbeek, Hessel , year =. Gender, Competitiveness, and Career Choices * , volume =. The Quarterly Journal of Economics , publisher =. doi:10.1093/qje/qju009 , number =

doi
[166]

Preferences and Biases in Educational Choices and Labour Market Expectations: Shrinking the Black Box of Gender , volume =

Reuben, Ernesto and Wiswall, Matthew and Zafar, Basit , year =. Preferences and Biases in Educational Choices and Labour Market Expectations: Shrinking the Black Box of Gender , volume =. The Economic Journal , publisher =. doi:10.1111/ecoj.12350 , number =

doi
[167]

Craig and Goldstein, Daniel G

Smith, N. Craig and Goldstein, Daniel G. and Johnson, Eric J. , year =. Choice without Awareness: Ethical and Policy Implications of Defaults , volume =. Journal of Public Policy & Marketing , publisher =. doi:10.1509/jppm.10.114 , number =

doi
[168]

and Liersch, Michael J

McKenzie, Craig R.M. and Liersch, Michael J. and Finkelstein, Stacey R. , year =. Recommendations Implicit in Policy Defaults , volume =. Psychological Science , publisher =. doi:10.1111/j.1467-9280.2006.01721.x , number =

2006
[169]

Social incentives for gender differences in the propensity to initiate negotiations: Sometimes it does hurt to ask , volume =

Bowles, Hannah Riley and Babcock, Linda and Lai, Lei , year =. Social incentives for gender differences in the propensity to initiate negotiations: Sometimes it does hurt to ask , volume =. Organizational Behavior and Human Decision Processes , publisher =. doi:10.1016/j.obhdp...

2006 doi
[170]

, year =

Brescoll, Victoria L. , year =. Who Takes the Floor and Why: Gender, Power, and Volubility in Organizations , volume =. Administrative Science Quarterly , publisher =. doi:10.1177/0001839212439994 , number =

doi
[171]

THE PEOPLE MAKE THE PLACE , volume =

Schneider, Benjamin , year =. THE PEOPLE MAKE THE PLACE , volume =. Personnel Psychology , publisher =. doi:10.1111/j.1744-6570.1987.tb00609.x , number =

1987
[172]

A Theory of Cognitive Dissonance , ISBN =

Festinger, Leon , year =. A Theory of Cognitive Dissonance , ISBN =. doi:10.1515/9781503620766 , publisher =

doi
[173]

and Collis, Manuela R

Coffman, Katherine B. and Collis, Manuela R. and Kulkarni, Leena , year =. Whether to Apply , volume =. Management Science , publisher =. doi:10.1287/mnsc.2023.4907 , number =

2023
[174]

Beliefs about Gender , volume =

Bordalo, Pedro and Coffman, Katherine and Gennaioli, Nicola and Shleifer, Andrei , year =. Beliefs about Gender , volume =. American Economic Review , publisher =. doi:10.1257/aer.20170007 , number =

doi
[175]

Evidence on Self-Stereotyping and the Contribution of Ideas * , volume =

Coffman, Katherine Baldiga , year =. Evidence on Self-Stereotyping and the Contribution of Ideas * , volume =. The Quarterly Journal of Economics , publisher =. doi:10.1093/qje/qju023 , number =

doi
[176]

Incentives and Prosocial Behavior , volume =

Bénabou, Roland and Tirole, Jean , year =. Incentives and Prosocial Behavior , volume =. American Economic Review , publisher =. doi:10.1257/aer.96.5.1652 , number =

doi
[177]

and Kahneman, D

Tversky, A. and Kahneman, D. , year =. Loss Aversion in Riskless Choice: A Reference-Dependent Model , volume =. The Quarterly Journal of Economics , publisher =. doi:10.2307/2937956 , number =

doi
[178]

and Stoker, Janka I

Rink, Floor and Ryan, Michelle K. and Stoker, Janka I. , year =. Influence in Times of Crisis: How Social and Financial Resources Affect Men’s and Women’s Evaluations of Glass-Cliff Positions , volume =. Psychological Science , publisher =. doi:10.1177/0956797612453115 , number =

doi
[179]

Image concerns in ex-ante self-assessments–Gender differences and behavioral consequences , volume =

Haeckl, Simone , year =. Image concerns in ex-ante self-assessments–Gender differences and behavioral consequences , volume =. doi:10.1016/j.labeco.2022.102166 , journal =

2022
[180]

A Reconsideration of Gender Differences in Risk Attitudes , volume =

Filippin, Antonio and Crosetto, Paolo , year =. A Reconsideration of Gender Differences in Risk Attitudes , volume =. Management Science , publisher =. doi:10.1287/mnsc.2015.2294 , number =

2015
[181]

, editor =

Batteux, Eleonore and Ferguson, Eamonn and Tunney, Richard J. , editor =. Do our risk preferences change when we make decisions for others? A meta-analysis of self-other differences in decisions involving risk , volume =. PLOS ONE , publisher =. 2019 , month = may, pages =. do...

2019 doi
[182]

Contextualizing the think crisis-think female stereotype in explaining the glass cliff: Gendered traits, gender, and type of crisis , volume =

Kulich, Clara and Gartzia, Leire and Komarraju, Meera and Aelenei, Cristina , editor =. Contextualizing the think crisis-think female stereotype in explaining the glass cliff: Gendered traits, gender, and type of crisis , volume =. PLOS ONE , publisher =. 2021 , month = mar, p...

2021 doi
[183]

and Ryan, Michelle K

Morgenroth, Thekla and Kirby, Teri A. and Ryan, Michelle K. and Sudk\". The who, when, and why of the glass cliff phenomenon: A meta-analysis of appointments to precarious leadership positions. , volume =. Psychological Bulletin , publisher =. 2020 , month = sep, pages =. doi:...

2020 doi
[184]

The glass cliff: When and why women are selected as leaders in crisis contexts , volume =

Bruckm\". The glass cliff: When and why women are selected as leaders in crisis contexts , volume =. British Journal of Social Psychology , publisher =. 2010 , month = sep, pages =. doi:10.1348/014466609x466594 , number =

2010 doi
[185]

Recall distortion and past choices , volume =

Heath, Rebecca and Roy-Chowdhury, Vivek , year =. Recall distortion and past choices , volume =. doi:10.1016/j.jebo.2025.107302 , journal =

2025
[186]

Roth , title =

Alvin E. Roth , title =. 2012 , note =

2012
[187]

and Charness, Gary and Ekstr\"

Cappelen, Alexander W. and Charness, Gary and Ekstr\". Exercise Improves Academic Performance , volume =. Journal of Political Economy , publisher =. 2026 , month = jan, pages =. doi:10.1086/738251 , number =

2026 doi
[188]

Creating Cohesive Communities: A Youth Camp Experiment in India , volume =

Ghosh, Arkadev and Kundu, Prerna and Lowe, Matt and Nellis, Gareth , year =. Creating Cohesive Communities: A Youth Camp Experiment in India , volume =. Review of Economic Studies , publisher =. doi:10.1093/restud/rdaf026 , number =

doi
[189]

and Sutter, Matthias , year =

Schneider, Sebastian O. and Sutter, Matthias , year =. Risk Preferences and Field Behavior: The Relevance of Higher-Order Risk Preferences , volume =. American Economic Review , publisher =. doi:10.1257/aer.20211217 , number =

doi
[190]

Attention Utility: Evidence from Individual Investors , volume =

Quispe-Torreblanca, Edika and Gathergood, John and Loewenstein, George and Stewart, Neil , year =. Attention Utility: Evidence from Individual Investors , volume =. Review of Economic Studies , publisher =. doi:10.1093/restud/rdaf028 , number =

doi
[191]

Retractions: Updating from Complex Information , volume =

Gon. Retractions: Updating from Complex Information , volume =. Review of Economic Studies , publisher =. 2026 , month = jan, pages =. doi:10.1093/restud/rdaf032 , number =

2026 doi
[192]

and Hickman, Brent R

Cotton, Christopher S. and Hickman, Brent R. and List, John A. and Price, Joseph and Roy, Sutanuka , year =. Why Don’t Struggling Students Do Their Homework? Disentangling Motivation and Study Productivity as Drivers of Human Capital Formation , volume =. Journal of Political ...

doi
[193]

Journal of Political Economy , volume =

An Experimental Imperfect Market , author =. Journal of Political Economy , volume =. 1948 , publisher =

1948
[194]

Conveniently Upset: Avoiding Altruism by Distorting Beliefs about Others’ Altruism , volume =

Di Tella, Rafael and Perez-Truglia, Ricardo and Babino, Andres and Sigman, Mariano , year =. Conveniently Upset: Avoiding Altruism by Distorting Beliefs about Others’ Altruism , volume =. American Economic Review , publisher =. doi:10.1257/aer.20141409 , number =

doi
[195]

Motivated memory in dictator games , volume =

Saucet, Charlotte and Villeval, Marie Claire , year =. Motivated memory in dictator games , volume =. doi:10.1016/j.geb.2019.05.011 , journal =

2019 doi
[196]

The Dynamics of Motivated Beliefs , volume =

Zimmermann, Florian , year =. The Dynamics of Motivated Beliefs , volume =. American Economic Review , publisher =. doi:10.1257/aer.20180728 , number =

doi
[197]

2025 , note =

Mission Possible: Data Quality in Online Surveys , author =. 2025 , note =

2025
[198]

Does gender matter for political leadership? The case of U.S

Ferreira, Fernando and Gyourko, Joseph , year =. Does gender matter for political leadership? The case of U.S. mayors , volume =. doi:10.1016/j.jpubeco.2014.01.006 , journal =

2014 doi
[199]

Pinar and S\"

Acar, F. Pinar and S\". Another Test of Gender Differences in Assignments to Precarious Leadership Positions: Examining the Moderating Role of Ambivalent Sexism , volume =. Applied Psychology , publisher =. 2018 , month = feb, pages =. doi:10.1111/apps.12142 , number =

2018 doi
[200]

doi:10.26300/7DG2-4D23 , url =

Student Demand For Relative Performance Feedback: Evidence from a Field Experiment , publisher =. doi:10.26300/7DG2-4D23 , url =

doi
[201]

Demand for information by gender: An experimental study , volume =

Sharma, Karmini and Castagnetti, Alessandro , year =. Demand for information by gender: An experimental study , volume =. doi:10.1016/j.jebo.2022.12.012 , journal =

2022 doi
[202]

Gender differences in reactions to feedback and willingness to compete , volume =

Berlin, Noémi and Dargnies, Marie-Pierre , year =. Gender differences in reactions to feedback and willingness to compete , volume =. doi:10.1016/j.jebo.2016.08.002 , journal =

2016 doi
[203]

Luck or skill: How women and men react to noisy feedback , volume =

Shastry, Gauri Kartini and Shurchkov, Olga and Xia, Lingjun Lotus , year =. Luck or skill: How women and men react to noisy feedback , volume =. doi:10.1016/j.socec.2020.101592 , journal =

2020
[204]

and Haslam, S

Ryan, Michelle K. and Haslam, S. Alexander , year =. The Glass Cliff: Evidence that Women are Over‐Represented in Precarious Leadership Positions , volume =. British Journal of Management , publisher =. doi:10.1111/j.1467-8551.2005.00433.x , number =

2005
[205]

and Haslam, S

Ryan, Michelle K. and Haslam, S. Alexander and Morgenroth, Thekla and Rink, Floor and Stoker, Janka and Peters, Kim , year =. Getting on top of the glass cliff: Reviewing a decade of evidence, explanations, and impact , volume =. The Leadership Quarterly , publisher =. doi:10....

2015 doi
[206]

and Clair, Judith A

Pearson, Christine M. and Clair, Judith A. , year =. Reframing Crisis Management , volume =. The Academy of Management Review , publisher =. doi:10.2307/259099 , number =

doi
[207]

and Jensen, Michael C

Fama, Eugene F. and Jensen, Michael C. , year =. Agency Problems and Residual Claims , ISSN =. doi:10.2139/ssrn.94032 , journal =

doi
[208]

and Jagannathan, Murali and Pritchard, A

Ferris, Stephen P. and Jagannathan, Murali and Pritchard, A. C. , year =. Too Busy to Mind the Business? Monitoring by Directors with Multiple Board Appointments , volume =. The Journal of Finance , publisher =. doi:10.1111/1540-6261.00559 , number =
[209]

Sector, size, stability, and scandal: Explaining the presence of female executives in Fortune500 firms , volume =

Brady, David and Isaacs, Katelin and Reeves, Martha and Burroway, Rebekah and Reynolds, Megan , year =. Sector, size, stability, and scandal: Explaining the presence of female executives in Fortune500 firms , volume =. Gender in Management: An International Journal , publisher...

doi
[210]

Women and Top Leadership Positions: Towards an Institutional Analysis , volume =

Cook, Alison and Glass, Christy , year =. Women and Top Leadership Positions: Towards an Institutional Analysis , volume =. Gender, Work & Organization , publisher =. doi:10.1111/gwao.12018 , number =

doi
[211]

Smith , journal =

Amy E. Smith , journal =. ON THE EDGE OF A GLASS CLIFF: WOMEN IN LEADERSHIP IN PUBLIC ORGANIZATIONS , urldate =
[212]

and Monaghan, Karen R

Smith, Amy E. and Monaghan, Karen R. , year =. Some Ceilings Have More Cracks: Representative Bureaucracy in Federal Regulatory Agencies , volume =. The American Review of Public Administration , publisher =. doi:10.1177/0275074011420997 , number =

doi
[213]

and Haslam, S

Ryan, Michelle K. and Haslam, S. Alexander and Kulich, Clara , year =. Politics and the Glass Cliff: Evidence that Women are Preferentially Selected to Contest Hard-to-Win Seats , volume =. Psychology of Women Quarterly , publisher =. doi:10.1111/j.1471-6402.2009.01541.x , number =

2009
[214]

Social Problems , publisher =

Cook, A and Glass, C , title =. Social Problems , publisher =. 2013 , month = may, pages =. doi:10.1525/sp.2013.60.2.168 , number =

2013 doi
[215]

and Gupta, Atul and Leeth, John D

Adams, Susan M. and Gupta, Atul and Leeth, John D. , year =. Are Female Executives Over‐represented in Precarious Leadership Positions? , volume =. British Journal of Management , publisher =. doi:10.1111/j.1467-8551.2007.00549.x , number =

2007
[216]

Board diversity in the perspective of financial distress: Empirical evidence from the Netherlands , volume =

Santen, Bernard and Donker, Han , year =. Board diversity in the perspective of financial distress: Empirical evidence from the Netherlands , volume =. Corporate Board role duties and composition , publisher =. doi:10.22495/cbv5i2art3 , number =

doi
[217]

Journal of Organizational Culture, Communications and Conflict , year=

Is There a "Glass Cliff or a Solid Ledge for Female Appointees to the Board of Directors? , author=. Journal of Organizational Culture, Communications and Conflict , year=
[218]

Breaking barriers: The impact of co-leadership on the gender gap in leadership participation , url =

Murad, Zahra and Ozturk, Emel , year =. Breaking barriers: The impact of co-leadership on the gender gap in leadership participation , url =. doi:10.2139/ssrn.5054412 , publisher =

doi
[219]

and Haslam, S

Ryan, Michelle K. and Haslam, S. Alexander and Hersby, Mette D. and Bongiorno, Renata , year =. Think crisis–think female: The glass cliff and contextual variation in the think manager–think male stereotype. , volume =. Journal of Applied Psychology , publisher =. doi:10.1037/...

doi
[220]

and Haslam, S

Ryan, Michelle K. and Haslam, S. Alexander , year =. The Glass Cliff: Exploring the Dynamics Surrounding the Appointment of Women to Precarious Leadership Positions , volume =. Academy of Management Review , publisher =. doi:10.5465/amr.2007.24351856 , number =

2007
[221]

, year =

Elsaid, Eahab and Ursel, Nancy D. , year =. Re‐examining the Glass Cliff Hypothesis using Survival Analysis: The Case of Female CEO Tenure , volume =. British Journal of Management , publisher =. doi:10.1111/1467-8551.12241 , number =
[222]

Shine Bright Like a Diamond: When Signaling Creates Glass Cliffs for Female Executives , volume =

Reinwald, Max and Zaia, Johannes and Kunze, Florian , year =. Shine Bright Like a Diamond: When Signaling Creates Glass Cliffs for Female Executives , volume =. Journal of Management , publisher =. doi:10.1177/01492063211067518 , number =

doi
[223]

Pathways to the Glass Cliff: A Risk Tax for Women and Minority Leaders? , volume =

Glass, Christy and Cook, Alison , year =. Pathways to the Glass Cliff: A Risk Tax for Women and Minority Leaders? , volume =. Social Problems , publisher =. doi:10.1093/socpro/spz045 , number =

doi
[224]

Grossman, Philip and Xue, Nina , year =

Eckel, Catherine and Gangadharan, Lata and J. Grossman, Philip and Xue, Nina , year =. The gender leadership gap: insights from experiments , ISBN =. doi:10.4337/9781789909852.00014 , booktitle =
[225]

The Grammar of Society: The Nature and Dynamics of Social Norms , ISBN =

Bicchieri, Cristina , year =. The Grammar of Society: The Nature and Dynamics of Social Norms , ISBN =. doi:10.1017/cbo9780511616037 , publisher =

doi
[226]

Social Norms and Private Provision of Public Goods , volume =

Rege, Mari , year =. Social Norms and Private Provision of Public Goods , volume =. Journal of Public Economic Theory , publisher =. doi:10.1111/j.1467-9779.2004.00157.x , number =

2004
[227]

On Her Own Account: How Strengthening Women’s Financial Control Impacts Labor Supply and Gender Norms , volume =

Field, Erica and Pande, Rohini and Rigol, Natalia and Schaner, Simone and Troyer Moore, Charity , year =. On Her Own Account: How Strengthening Women’s Financial Control Impacts Labor Supply and Gender Norms , volume =. American Economic Review , publisher =. doi:10.1257/aer.2...

doi
[228]

, year =

Ridgeway, Cecilia L. , year =. Gender, Status, and Leadership , volume =. Journal of Social Issues , publisher =. doi:10.1111/0022-4537.00233 , number =
[229]

, year =

Heckman, James J. , year =. Econometric Causality , volume =. International Statistical Review , publisher =. doi:10.1111/j.1751-5823.2007.00024.x , number =

2007
[230]

Field Experiments , volume =

Harrison, Glenn W and List, John A , year =. Field Experiments , volume =. Journal of Economic Literature , publisher =. doi:10.1257/0022051043004577 , number =

doi
[231]

, year =

Charness, Gary and Gneezy, Uri and Kuhn, Michael A. , year =. Experimental methods: Extra-laboratory experiments-extending the reach of experimental economics , volume =. doi:10.1016/j.jebo.2013.04.002 , journal =

2013 doi
[232]

, year =

Voslinsky, Alisa and Azar, Ofer H. , year =. Incentives in experimental economics , volume =. doi:10.1016/j.socec.2021.101706 , journal =

2021
[233]

Nudging Farmers to Use Fertilizer: Theory and Experimental Evidence from Kenya , volume =

Duflo, Esther and Kremer, Michael and Robinson, Jonathan , year =. Nudging Farmers to Use Fertilizer: Theory and Experimental Evidence from Kenya , volume =. American Economic Review , publisher =. doi:10.1257/aer.101.6.2350 , number =

doi
[234]

How High Are Rates of Return to Fertilizer? Evidence from Field Experiments in Kenya , volume =

Duflo, Esther and Kremer, Michael and Robinson, Jonathan , year =. How High Are Rates of Return to Fertilizer? Evidence from Field Experiments in Kenya , volume =. American Economic Review , publisher =. doi:10.1257/aer.98.2.482 , number =

doi
[235]

Press release: The Prize in Economic Sciences 2019 , year =

2019
[236]

Lab-in-the-field experiments: perspectives from research on gender , volume =

Gangadharan, Lata and Jain, Tarun and Maitra, Pushkar and Vecci, Joe , year =. Lab-in-the-field experiments: perspectives from research on gender , volume =. The Japanese Economic Review , publisher =. doi:10.1007/s42973-021-00088-6 , number =

doi
[237]

Explanation in causal inference: Methods for mediation and interaction

VanderWeele, Tyler. Explanation in causal inference: Methods for mediation and interaction
[238]

CAUSAL ANALYSIS AFTER HAAVELMO , volume =

Heckman, James and Pinto, Rodrigo , year =. CAUSAL ANALYSIS AFTER HAAVELMO , volume =. Econometric Theory , publisher =. doi:10.1017/s026646661400022x , number =

doi
[239]

and Howland, Laura , year =

Anderson, Cameron and Hildreth, John Angus D. and Howland, Laura , year =. Is the desire for status a fundamental human motive? A review of the empirical literature. , volume =. Psychological Bulletin , publisher =. doi:10.1037/a0038781 , number =

doi
[240]

and Fast, Nathanael J

Anicich, Eric M. and Fast, Nathanael J. and Halevy, Nir and Galinsky, Adam D. , year =. When the Bases of Social Hierarchy Collide: Power Without Status Drives Interpersonal Conflict , volume =. Organization Science , publisher =. doi:10.1287/orsc.2015.1019 , number =

2015
[241]

, year =

Narayanan, Lakshmi and Menon, Shanker and Spector, Paul E. , year =. Stress in the workplace: a comparison of gender and occupations , volume =. Journal of Organizational Behavior , publisher =. doi:10.1002/(sici)1099-1379(199901)20:1<63::aid-job873>3.0.co;2-j , number =

doi
[242]

and Boswell, Wendy R

Cavanaugh, Marcie A. and Boswell, Wendy R. and Roehling, Mark V. and Boudreau, John W. , year =. An empirical examination of self-reported work stress among U.S. managers. , volume =. Journal of Applied Psychology , publisher =. doi:10.1037/0021-9010.85.1.65 , number =

doi
[243]

A Systematic Literature Review of Work Stress , volume =

Burman, Richa and Goswami, Tulsee Giri , year =. A Systematic Literature Review of Work Stress , volume =. International Journal of Management Studies , publisher =. doi:10.18843/ijms/v5i3(9)/15 , number =

doi
[244]

Why do people follow social norms? , volume =

Gross, J\". Why do people follow social norms? , volume =. 2022 , month = apr, pages =. doi:10.1016/j.copsyc.2021.08.016 , journal =

2022 doi
[245]

and Dasborough, Marie T

Collins, Michael D. and Dasborough, Marie T. and Gregg, Heath R. and Xu, Changmeng and Midel Deen, Catherine and He, Yaqing and Restubog, Simon Lloyd D. , year =. Traversing the storm: An interdisciplinary review of crisis leadership , volume =. The Leadership Quarterly , publ...

2022
[246]

Employee Performance and Mental Well-Being: The Mitigating Effects of Transformational Leadership During Crisis , ISSN =

Czura, Kristina and Englmaier, Florian and Ho, Hoa and Spantig, Lisa , year =. Employee Performance and Mental Well-Being: The Mitigating Effects of Transformational Leadership During Crisis , ISSN =. doi:10.1287/mnsc.2023.03285 , journal =

2023
[247]

and Ryan, Michelle K

Ashby, Julie S. and Ryan, Michelle K. and Haslam, S. Alexander , title =. William & Mary Journal of Women and the Law , volume =. 2007 , url =

2007
[248]

and Martin, Carol Lynn and Berenbaum, Sheri A

Ruble, Diane N. and Martin, Carol Lynn and Berenbaum, Sheri A. , title =. Handbook of Child Psychology: Social, Emotional, and Personality Development , editor =
[249]

Econometric analysis of cross section and panel data

Wooldridge, Jeffrey M. Econometric analysis of cross section and panel data
[250]

What Do Instrumental Variable Models Deliver with Discrete Dependent Variables? , volume =

Chesher, Andrew and Rosen, Adam M , year =. What Do Instrumental Variable Models Deliver with Discrete Dependent Variables? , volume =. American Economic Review , publisher =. doi:10.1257/aer.103.3.557 , number =

doi
[251]

Under what conditions do gender differences exist in power and achievement values? The moderating role of gender ideology , volume =

Prati, Gabriele and Stefani, Serena , year =. Under what conditions do gender differences exist in power and achievement values? The moderating role of gender ideology , volume =. Asian Journal of Social Psychology , publisher =. doi:10.1111/ajsp.12588 , number =

doi
[252]

and Rubel, Tammy , year =

Schwartz, Shalom H. and Rubel, Tammy , year =. Sex differences in value priorities: Cross-cultural and multimethod studies. , volume =. Journal of Personality and Social Psychology , publisher =. doi:10.1037/0022-3514.89.6.1010 , number =

doi
[253]

, year =

Sagiv, Lilach and Roccas, Sonia and Cieciuch, Jan and Schwartz, Shalom H. , year =. Personal values in human life , volume =. Nature Human Behaviour , publisher =. doi:10.1038/s41562-017-0185-3 , number =

doi
[254]

and Rubel-Lifschitz, Tammy , year =

Schwartz, Shalom H. and Rubel-Lifschitz, Tammy , year =. Cross-national variation in the size of sex differences in values: Effects of gender equality. , volume =. Journal of Personality and Social Psychology , publisher =. doi:10.1037/a0015546 , number =

doi
[255]

, year =

Ertac, Seda and Gumren, Mert and Gurdal, Mehmet Y. , year =. Demand for decision autonomy and the desire to avoid responsibility in risky environments: Experimental evidence , volume =. doi:10.1016/j.joep.2019.102200 , journal =

2019
[256]

and Caviola, Lucius and Kahane, Guy and Savulescu, Julian and Faber, Nadira S

Everett, Jim A.C. and Caviola, Lucius and Kahane, Guy and Savulescu, Julian and Faber, Nadira S. , year =. Doing good by doing nothing? The role of social norms in explaining default effects in altruistic contexts , volume =. European Journal of Social Psychology , publisher =...

doi
[257]

The Quest for QWERTY , volume =

Hossain, Tanjim and Morgan, John , year =. The Quest for QWERTY , volume =. American Economic Review , publisher =. doi:10.1257/aer.99.2.435 , number =

doi
[259]

, year =

Rietveld, Joost and Schilling, Melissa A. , year =. Platform Competition: A Systematic and Interdisciplinary Review of the Literature , volume =. Journal of Management , publisher =. doi:10.1177/0149206320969791 , number =

doi
[260]

Glen , year =

Weyl, E. Glen , year =. A Price Theory of Multi-Sided Platforms , volume =. American Economic Review , publisher =. doi:10.1257/aer.100.4.1642 , number =

doi
[261]

Platform Competition in Two-Sided Markets , volume =

Rochet, Jean-Charles and Tirole, Jean , year =. Platform Competition in Two-Sided Markets , volume =. Journal of the European Economic Association , publisher =. doi:10.1162/154247603322493212 , number =

doi
[262]

J and Margolis, Stephen E , year =

Liebowitz, S. J and Margolis, Stephen E , year =. Network Externality: An Uncommon Tragedy , volume =. Journal of Economic Perspectives , publisher =. doi:10.1257/jep.8.2.133 , number =

doi
[264]

The Economics of Two-Sided Markets , volume =

Rysman, Marc , year =. The Economics of Two-Sided Markets , volume =. Journal of Economic Perspectives , publisher =. doi:10.1257/jep.23.3.125 , number =

doi
[265]

Two-sided markets: a progress report , volume =

Rochet, Jean-Charles and Tirole, Jean , year =. Two-sided markets: a progress report , volume =. The RAND Journal of Economics , publisher =. doi:10.1111/j.1756-2171.2006.tb00036.x , number =

2006
[266]

Chicken & Egg: Competition among Intermediation Service Providers , volume =

Caillaud, Bernard and Jullien, Bruno , year =. Chicken & Egg: Competition among Intermediation Service Providers , volume =. The RAND Journal of Economics , publisher =. doi:10.2307/1593720 , number =

doi
[267]

and Friedman, D

Cassar, A. and Friedman, D. and Schneider, P. H. , year =. A Laboratory Investigation of Networked Markets , volume =. The Economic Journal , publisher =. doi:10.1111/j.1468-0297.2009.02326.x , number =

2009
[268]

MULTISIDED PLATFORMS AND MARKETS: A SURVEY OF THE THEORETICAL LITERATURE , volume =

Sanchez‐Cartas, Juan Manuel and León, Gonzalo , year =. MULTISIDED PLATFORMS AND MARKETS: A SURVEY OF THE THEORETICAL LITERATURE , volume =. Journal of Economic Surveys , publisher =. doi:10.1111/joes.12409 , number =

doi
[269]

Cheating in markets: A laboratory experiment , volume =

Cassar, Alessandra and Friedman, Daniel and Schneider, Patricia Higino , year =. Cheating in markets: A laboratory experiment , volume =. Journal of Economic Behavior & Organization , publisher =. doi:10.1016/j.jebo.2009.03.015 , number =

2009 doi
[270]

COMMUNICATION AND MARKET SHARING: AN EXPERIMENT ON THE EXCHANGE OF SOFT AND HARD INFORMATION , volume =

Freitag, Andreas and Roux, Catherine and Th\". COMMUNICATION AND MARKET SHARING: AN EXPERIMENT ON THE EXCHANGE OF SOFT AND HARD INFORMATION , volume =. International Economic Review , publisher =. 2020 , month = sep, pages =. doi:10.1111/iere.12480 , number =

2020 doi
[271]

Pavel Durov , title =
[272]

Telegram FAQ: What is Telegram? What do I do here? , year =
[273]

Dynamic competition with network externalities: how history matters , volume =

Halaburda, Hanna and Jullien, Bruno and Yehezkel, Yaron , year =. Dynamic competition with network externalities: how history matters , volume =. The RAND Journal of Economics , publisher =. doi:10.1111/1756-2171.12304 , number =
[274]

When Do Markets Tip? A Cognitive Hierarchy Approach , volume =

Hossain, Tanjim and Morgan, John , year =. When Do Markets Tip? A Cognitive Hierarchy Approach , volume =. Marketing Science , publisher =. doi:10.1287/mksc.1120.0770 , number =
[275]

History as a coordination device , volume =

Argenziano, Rossella and Gilboa, Itzhak , year =. History as a coordination device , volume =. Theory and Decision , publisher =. doi:10.1007/s11238-011-9264-5 , number =

doi
[276]

Update about the October 4 outage , year = 2021, url =

2021
[277]

Predatory pricing with the existence of network externalities in the laboratory , volume =

Chiaravutthi, Yingyot , year =. Predatory pricing with the existence of network externalities in the laboratory , volume =. Information Economics and Policy , publisher =. doi:10.1016/j.infoecopol.2007.01.005 , number =

2007 doi
[278]

, year =

Harrison, Glenn W. , year =. Predatory pricing in a multiple market experiment , volume =. Journal of Economic Behavior & Organization , publisher =. doi:10.1016/0167-2681(88)90019-4 , number =

doi
[279]

Platform selection in the lab , volume =

Heggedal, Tom-Reiel and Helland, Leif , year =. Platform selection in the lab , volume =. doi:10.1016/j.jebo.2013.12.004 , journal =

2013 doi
[280]

Competing Matchmakers: An Experimental Analysis , volume =

Hossain, Tanjim and Minor, Dylan and Morgan, John , year =. Competing Matchmakers: An Experimental Analysis , volume =. Management Science , publisher =. doi:10.1287/mnsc.1110.1407 , number =

arXiv
[281]

Libertarian Paternalism , volume =

Thaler, Richard H and Sunstein, Cass R , year =. Libertarian Paternalism , volume =. American Economic Review , publisher =. doi:10.1257/000282803321947001 , number =

doi
[282]

Prolific.ac—A subject pool for online experiments , volume =

Palan, Stefan and Schitter, Christian , year =. Prolific.ac—A subject pool for online experiments , volume =. doi:10.1016/j.jbef.2017.12.004 , journal =

2017 doi
[283]

Evaluating Online Data Collection Platforms Using A Simple Rule-Following Task , volume =

Suri, Dominik and Kube, Sebastian and Schultz, Johannes , year =. Evaluating Online Data Collection Platforms Using A Simple Rule-Following Task , volume =. doi:10.1016/j.econlet.2025.112509 , journal =

2025
[284]

and Ewell, Patrick J

Douglas, Benjamin D. and Ewell, Patrick J. and Brauer, Markus , editor =. Data quality in online human-subjects research: Comparisons between MTurk, Prolific, CloudResearch, Qualtrics, and SONA , volume =. PLOS ONE , publisher =. 2023 , month = mar, pages =. doi:10.1371/journa...

2023 doi
[285]

and Smilek, Daniel , year =

Albert, Derek A. and Smilek, Daniel , year =. Comparing attentional disengagement between Prolific and MTurk samples , volume =. Scientific Reports , publisher =. doi:10.1038/s41598-023-46048-5 , number =

doi
[286]

and Rand, David G

Arechar, Antonio A. and Rand, David G. , year =. Turking in the time of COVID , volume =. Behavior Research Methods , publisher =. doi:10.3758/s13428-021-01588-4 , number =

doi
[287]

, year =

Chmielewski, Michael and Kucker, Sarah C. , year =. An MTurk Crisis? Shifts in Data Quality and the Impact on Study Results , volume =. Social Psychological and Personality Science , publisher =. doi:10.1177/1948550619875149 , number =

doi
[288]

, year =

Bouchouicha, Ranoua and Deer, Lachlan and Eid, Ashraf Galal and McGee, Peter and Schoch, Daniel and Stojic, Hrvoje and Ygosse-Battisti, Jolanda and Vieider, Ferdinand M. , year =. Gender effects for loss aversion: Yes, no, maybe? , volume =. Journal of Risk and Uncertainty , p...

doi
[289]

Gender effects for loss aversion: A reconsideration , volume =

Georgalos, Konstantinos , year =. Gender effects for loss aversion: A reconsideration , volume =. doi:10.1016/j.joep.2024.102760 , journal =

2024
[290]

Leadership? No, Thanks!

Aycan, Zeynep and Shelia, Salome , year =. “Leadership? No, Thanks!” A New Construct: Worries About Leadership , volume =. European Management Review , publisher =. doi:10.1111/emre.12322 , number =

doi
[291]

Exploring the Sex Difference in Affective Motivation to Lead: Furthering the Understanding of Women’s Underrepresentation in Leadership Positions , volume =

Elprana, Gwen and Felfe, J\". Exploring the Sex Difference in Affective Motivation to Lead: Furthering the Understanding of Women’s Underrepresentation in Leadership Positions , volume =. Journal of Personnel Psychology , publisher =. 2015 , month = jul, pages =. doi:10.1027/1...

2015 doi
[292]

Do you feel like becoming a leader?

Shelia, Salome and Aycan, Zeynep , year =. “Do you feel like becoming a leader?” Emotions and the likelihood of self-nomination for leadership , volume =. The Leadership Quarterly , publisher =. doi:10.1016/j.leaqua.2022.101643 , number =

2022
[293]

Self–other decision making and loss aversion , volume =

Polman, Evan , year =. Self–other decision making and loss aversion , volume =. Organizational Behavior and Human Decision Processes , publisher =. doi:10.1016/j.obhdp.2012.06.005 , number =

2012 doi
[294]

Taking the initiative

Bruttel, Lisa and Fischbacher, Urs , year =. Taking the initiative. What characterizes leaders? , volume =. doi:10.1016/j.euroecorev.2013.08.008 , journal =

2013 doi
[295]

Discrimination from below: Experimental evidence from Ethiopia , volume =

Ayalew, Shibiru and Manian, Shanthi and Sheth, Ketki , year =. Discrimination from below: Experimental evidence from Ethiopia , volume =. doi:10.1016/j.jdeveco.2021.102653 , journal =

2021
[296]

Does the Gender Composition of Scientific Committees Matter? , volume =

Bagues, Manuel and Sylos-Labini, Mauro and Zinovyeva, Natalia , year =. Does the Gender Composition of Scientific Committees Matter? , volume =. American Economic Review , publisher =. doi:10.1257/aer.20151211 , number =

doi
[297]

Stereotypes* , volume =

Bordalo, Pedro and Coffman, Katherine and Gennaioli, Nicola and Shleifer, Andrei , year =. Stereotypes* , volume =. The Quarterly Journal of Economics , publisher =. doi:10.1093/qje/qjw029 , number =

doi
[298]

Gender and Willingness to Lead: Does the Gender Composition of Teams Matter? , volume =

Born, Andreas and Ranehill, Eva and Sandberg, Anna , year =. Gender and Willingness to Lead: Does the Gender Composition of Teams Matter? , volume =. The Review of Economics and Statistics , publisher =. doi:10.1162/rest_a_00955 , number =

doi
[299]

Gender and Leadership in Organisations: the Threat of Backlash , volume =

Chakraborty, Priyanka and Serra, Danila , year =. Gender and Leadership in Organisations: the Threat of Backlash , volume =. The Economic Journal , publisher =. doi:10.1093/ej/uead110 , number =

doi
[300]

A (dynamic) investigation of stereotypes, belief‐updating, and behavior , volume =

Coffman, Katherine and Ugalde Araya, Maria Paola and Zafar, Basit , year =. A (dynamic) investigation of stereotypes, belief‐updating, and behavior , volume =. Economic Inquiry , publisher =. doi:10.1111/ecin.13219 , number =

doi

Pith tools

Reviewed July 31, 2026 · model on record in the stance chip above.

[1] [1]

2022 , month = sep, publisher =

Sherry He and Brett Hollenbeck and Davide Proserpio , title =. 2022 , month = sep, publisher =. doi:10.1287/mksc.2022.1353 , url =

arXiv 2022

[2] [2]

1993 , publisher =

Diego Gambetta , title =. 1993 , publisher =

1993

[3] [3]

Offline and Local: The Hidden Face of Cybercrime , volume =

Lusthaus, Jonathan and Varese, Federico , year =. Offline and Local: The Hidden Face of Cybercrime , volume =. Policing: A Journal of Policy and Practice , publisher =. doi:10.1093/police/pax042 , number =

work page doi:10.1093/police/pax042

[4] [4]

2025 , publisher =

Peter Andreas , title =. 2025 , publisher =

2025

[5] [5]

2025 , publisher =

Mark Galeotti , title =. 2025 , publisher =

2025

[6] [6]

Roth, A. E. and Sonmez, T. and Unver, M. U. , year =. Kidney Exchange , volume =. The Quarterly Journal of Economics , publisher =. doi:10.1162/0033553041382157 , number =

doi:10.1162/0033553041382157

[7] [7]

Market Design: The Policy Uses of Theory , volume =

McMillan, John , year =. Market Design: The Policy Uses of Theory , volume =. American Economic Review , publisher =. doi:10.1257/000282803321946949 , number =

work page doi:10.1257/000282803321946949

[8] [8]

Experimental Methods: A Primer for Economists , ISBN =

Friedman, Daniel and Sunder, Shyam , year =. Experimental Methods: A Primer for Economists , ISBN =. doi:10.1017/cbo9781139174176 , publisher =

work page doi:10.1017/cbo9781139174176