pith. sign in

arxiv: astro-ph/9910516 · v1 · submitted 1999-10-28 · 🌌 astro-ph

The INES System III: Evaluation of IUE NEWSIPS High Resolution Spectra

classification 🌌 astro-ph
keywords resolutionspectrahighwavelengthnewsipsscaleinessystem
0
0 comments X
read the original abstract

This paper discusses the overall quality of IUE high resolution data processed with the NEWSIPS software in terms of flux and wavelength accuracy. It also describes the processing of NEWSIPS high resolution spectra within the framework of the ESA ``IUE Newly Extracted Spectra'' (INES) System. This system provides the IUE high resolution data in two formats: the high resolution ``concatenated'' spectra, in which the spectral orders are connected, eliminating the overlap regions through a procedure designed to optimize the signal-to-noise ratio at the edges of the orders, and the ``rebinned'' spectra, i.e. the high resolution concatenated spectra resampled into the low resolution wavelength domain. Our study reveals the existence of a significant discrepancy in the wavelength scales of short and long wavelength NEWSIPS high resolution spectra. The INES processing applies a correction of +17.7 km/s to the wavelength scale of the high resolution SWP spectra in order to provide an internally consistent velocity scale. Similarly, suitable corrections have been applied to long wavelength small aperture spectra. The new wavelength scale is, within the errors, in good agreement with the optical velocity scale.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.