pith. sign in

arxiv: 0804.4178 · v1 · submitted 2008-04-25 · ⚛️ physics.bio-ph · q-bio.QM

Molecular motion in cell membranes: analytic study of fence-hindered random walks

classification ⚛️ physics.bio-ph q-bio.QM
keywords celldiffusionanalyticconfineddisplacementkidneymeanmembranes
0
0 comments X
read the original abstract

A theoretical calculation is presented to describe the confined motion of transmembrane molecules in cell membranes. The study is analytic, based on Master equations for the probability of the molecules moving as random walkers, and leads to explicit usable solutions including expressions for the molecular mean square displacement and effective diffusion constants. One outcome is a detailed understanding of the dependence of the time variation of the mean square displacement on the initial placement of the molecule within the confined region. How to use the calculations is illustrated by extracting (confinement) compartment sizes from experimentally reported published observations from single particle tracking experiments on the diffusion of gold-tagged G-protein coupled mu-opioid receptors in the normal rat kidney cell membrane, and by further comparing the analytical results to observations on the diffusion of phospholipids, also in normal rat kidney cells.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.