pith. sign in

arxiv: 0811.0781 · v1 · submitted 2008-11-05 · 🧬 q-bio.BM · cond-mat.soft

Crowding effects on the mechanical stability and unfolding pathways of Ubiquitin

classification 🧬 q-bio.BM cond-mat.soft
keywords crowdingunfoldingfracpathwaysaverageeffectsforcemechanical
0
0 comments X
read the original abstract

The interior of cells is crowded thus making it important to assess the effects of macromolecules on the folding of proteins. Using the Self-Organized Polymer (SOP) model, which is a coarse-grained representation of polypeptide chains, we probe the mechanical stability of Ubiquitin (Ub) monomers and trimers ((Ub)$_3$) in the presence of monodisperse spherical crowding agents. Crowding increases the volume fraction ($\Phi_c$)-dependent average force ($<f_u(\Phi_c)>$), relative to the value at $\Phi_c = 0$, needed to unfold Ub and the polyprotein. For a given $\Phi_c$, the values of $<f_u(\Phi_c)>$ increase as the diameter ($\sigma_c$) of the crowding particles decreases. The average unfolding force $<f_u(\Phi_c)>$ depends on the ratio $\frac{D}{R_g}$, where $D \approx \sigma_c (\frac{\pi}{6 \Phi_c})^{{1/3}}$ with $R_g$ being the radius of gyration of Ub (or (Ub)$_3$) in the unfolded state. Examination of the unfolding pathways shows that, relative to $\Phi_c = 0$, crowding promotes reassociation of ruptured secondary structural elements. Both the nature of the unfolding pathways and $<f_u(\Phi_c)>$ for (Ub)$_3$ are altered in the presence of crowding particles with the effect being most dramatic for the subunit that unfolds last. We predict, based on SOP simulations and theoretical arguments, that $<f_u(\Phi_c) > \sim \Phi_c^{\frac{1}{3\nu}}$, where $\nu$ is the Flory exponent that describes the unfolded (random coil) state of the protein.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.