Anisotropic charge dynamics in detwinned Ba(Fe_(1-x)Co_x)₂As₂
classification
❄️ cond-mat.supr-con
keywords
anisotropicchargedetwinneddynamicsfrequenciesstructuralacrossallow
read the original abstract
We investigate the optical conductivity as a function of temperature with light polarized along the in-plane orthorhombic $a$- and $b$-axes of Ba(Fe$_{1-x}$Co$_x$)$_2$As$_2$ for $x$=0 and 2.5$\%$ under uniaxial pressure. The charge dynamics at low frequencies on these detwinned, single domain compounds tracks the anisotropic $dc$ transport properties across their structural and magnetic phase transitions. Our findings allow us to estimate the dichroism, which extends to relatively high frequencies. These results are consistent with a scenario in which orbital order plays a significant role in the tetragonal-to-orthorhombic structural transition.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.