pith. sign in

arxiv: 1203.2558 · v3 · pith:FN2EA6HVnew · submitted 2012-03-12 · 🌌 astro-ph.IM · astro-ph.CO

A way to deal with the fringe-like pattern in VIMOS-IFU data

classification 🌌 astro-ph.IM astro-ph.CO
keywords fringe-likepatterndataspectralvimos-ifuintensitymethodpipeline
0
0 comments X
read the original abstract

The use of integral field units is now commonplace at all major observatories offering efficient means of obtaining spectral as well as imaging information at the same time. IFU instrument designs are complex and spectral images have typically highly condensed formats, therefore presenting challenges for the IFU data reduction pipelines. In the case of the VLT VIMOS-IFU, a fringe-like pattern affecting the spectra well into the optical and blue wavelength regime as well as artificial intensity variations, require additional reduction steps beyond standard pipeline processing. In this research note we propose an empirical method for the removal of the fringe-like pattern in the spectral domain and the intensity variations in the imaging domain. We also demonstrate the potential consequences for data analysis if the effects are not corrected. Here we use the example of deriving stellar velocity, velocity dispersion and absorption line-strength maps for early-type galaxies. We derive for each spectrum, reduced by the ESO standard VIMOS pipeline, a correction-spectrum by using the median of the eight surrounding spectra as a proxy for the unaffected, underlying spectrum. This method relies on the fact that our science targets (nearby ETGs) cover the complete FoV of the VIMOS-IFU with slowly varying spectral properties and that the exact shape of the fringe-like pattern is nearly independent and highly variable between neighboring spatial positions. We find that the proposed correction methods for the removal of the fringe-like pattern and the intensity variations in VIMOS-IFU data-cubes are suitable to allow for meaningful data analysis in our sample of nearby early-type galaxies. Since the method relies on the scientific target properties it is not suitable for general implementation in the pipeline software for VIMOS.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.