pith. sign in

arxiv: 1409.8550 · v1 · pith:VCRXBKRFnew · submitted 2014-09-30 · 🧮 math-ph · math.MP

Lie bundle on the space of deformed skew-symmetric matrices

classification 🧮 math-ph math.MP
keywords deformedldotsmatricesmathcalskew-symmetricspacestructurealgebra
0
0 comments X
read the original abstract

We study a Lie algebra $\mathcal A_{a_1,\ldots,a_{n-1}}$ of deformed skew-symmetric $n \times n$ matrices endowed with a Lie bracket given by a choice of deformed symmetric matrix. The deformations are parametrized by a sequence of real numbers $a_1,\ldots,a_{n-1}$. Using isomorphism $\mathcal A_{a_1,\ldots,a_{n-1}}^* \cong L_+$ we introduce a Lie-Poisson structure on the space of upper-triangular matrices $L_+$. In this way we generate hierarchies of Hamilton systems with bihamiltonian structure.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.