Lie bundle on the space of deformed skew-symmetric matrices
classification
🧮 math-ph
math.MP
keywords
deformedldotsmatricesmathcalskew-symmetricspacestructurealgebra
read the original abstract
We study a Lie algebra $\mathcal A_{a_1,\ldots,a_{n-1}}$ of deformed skew-symmetric $n \times n$ matrices endowed with a Lie bracket given by a choice of deformed symmetric matrix. The deformations are parametrized by a sequence of real numbers $a_1,\ldots,a_{n-1}$. Using isomorphism $\mathcal A_{a_1,\ldots,a_{n-1}}^* \cong L_+$ we introduce a Lie-Poisson structure on the space of upper-triangular matrices $L_+$. In this way we generate hierarchies of Hamilton systems with bihamiltonian structure.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.