Recognition: unknown
Spin waves in one-dimensional bi-component quasicrystals
classification
❄️ cond-mat.mes-hall
keywords
quasicrystalsspinwavesfinitemagnonicstructurealignedbi-component
read the original abstract
We studied finite Fibonacci sequence of Co and Py stripes aligned side-by-side and in direct contact with each other. Calculations based on continuous model including exchange and dipole interactions were performed for structures feasible for fabrication and characterization of main properties of magnonic quasicrystals. We have shown the fractal structure of the magnonic spectrum with a number of magnonics gaps of different width. Also localization of spin waves in quasicrystals and existence of surface spin waves in finite quaiscrystal structure is demonstrated.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.