pith. machine review for the scientific record. sign in

arxiv: 1506.04097 · v1 · submitted 2015-06-12 · ❄️ cond-mat.mes-hall

Recognition: unknown

Phase-coherent transport in catalyst-free vapor phase deposited Bi₂Se₃ crystals

Authors on Pith no claims yet
classification ❄️ cond-mat.mes-hall
keywords electroncatalyst-freedevicesfieldsfindflakesmagneto-resistancemeasurements
0
0 comments X
read the original abstract

Free-standing Bi$_2$Se$_3$ single crystal flakes of variable thickness are grown using a catalyst-free vapor-solid synthesis and are subsequently transferred onto a clean Si$^{++}$/SiO$_2$ substrate where the flakes are contacted in Hall bar geometry. Low temperature magneto-resistance measurements are presented which show a linear magneto-resistance for high magnetic fields and weak anti-localization (WAL) at low fields. Despite an overall strong charge carrier tunability for thinner devices, we find that electron transport is dominated by bulk contributions for all devices. Phase coherence lengths $\l_\phi$ as extracted from WAL measurements increase linearly with increasing electron density exceeding $1 \mu $m at 1.7 K. While $\l_\phi$ is in qualitative agreement with electron electron interaction-induced dephasing, we find that spin flip scattering processes limit $\l_\phi$ at low temperatures.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.