pith. sign in

arxiv: 1508.00011 · v3 · pith:ZVYHRC6Dnew · submitted 2015-07-31 · ✦ hep-ph · astro-ph.CO

Peccei-Quinn field for inflation, baryogenesis, dark matter, and much more

classification ✦ hep-ph astro-ph.CO
keywords darkfieldmassmathcalmathrmmatterparameterpeccei-quinn
0
0 comments X
read the original abstract

We propose a scenario of brane cosmology in which the Peccei-Quinn field plays the role of the inflaton and solves simultaneously many cosmological and phenomenological issues such as the generation of a heavy Majorana mass for the right-handed neutrinos needed for seesaw mechanism, MSSM $\mu$-parameter, the right amount of baryon number asymmetry and dark matter relic density at the present universe, together with an axion solution to the strong CP problem without the domain wall obstacle. Interestingly, the scales of the soft SUSY-breaking mass parameter and that of the breaking of $U(1)_{\rm PQ}$ symmetry are lower bounded at $\mathcal{O}(10) {\mathrm TeV}$ and $\mathcal{O}(10^{11}) {\mathrm GeV}$, respectively.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.