Pith. sign in

REVIEW

Non-Hemolytic Peptide Classification Using A Quantum Support Vector Machine

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2402.03847 v1 pith:BHUV53MJ submitted 2024-02-06 quant-ph

classification quant-ph
keywords classificationquantumqsvmtaskclassicalmachinepeptidebest
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

Quantum machine learning (QML) is one of the most promising applications of quantum computation. However, it is still unclear whether quantum advantages exist when the data is of a classical nature and the search for practical, real-world applications of QML remains active. In this work, we apply the well-studied quantum support vector machine (QSVM), a powerful QML model, to a binary classification task which classifies peptides as either hemolytic or non-hemolytic. Using three peptide datasets, we apply and contrast the performance of the QSVM, numerous classical SVMs, and the best published results on the same peptide classification task, out of which the QSVM performs best. The contributions of this work include (i) the first application of the QSVM to this specific peptide classification task, (ii) an explicit demonstration of QSVMs outperforming the best published results attained with classical machine learning models on this classification task and (iii) empirical results showing that the QSVM is capable of outperforming many (and possibly all) classical SVMs on this classification task. This foundational work paves the way to verifiable quantum advantages in the field of computational biology and facilitates safer therapeutic development.

Discussion (0). Continue with ORCID to comment.

Pith tools