pith. sign in

arxiv: gr-qc/0211081 · v1 · submitted 2002-11-25 · 🌀 gr-qc

Thick domain wall spacetimes with and without reflection symmetry

classification 🌀 gr-qc
keywords asymmetricspacetimeswallsreflectionsolutionssymmetrywallcase
0
0 comments X
read the original abstract

We show that the spacetimes of domain wall solutions to the coupled Einstein-scalar field equations with a given scalar field potential fall into two classes, depending on whether or not reflection symmetry on the wall is imposed. Solutions with reflection symmetry are dynamic, while the asymmetric ones are static. Asymmetric walls are asymptotically flat on one side and reduce to the Taub spacetime on the other. Examples of asymmetric thick walls in D-dimensional spacetimes are given, and results on the thin-wall limit of the dynamic, symmetric walls are extended to the asymmetric case. The particular case of symmetric, static spacetimes is considered and a new family of solutions, including previously known BPS walls, is presented.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Quasinormal modes of the thick braneworld in $f(T)$ gravity

    gr-qc 2026-04 unverdicted novelty 5.0

    In a thick braneworld model with f(T) = T + α T², the parameter α induces brane splitting and alters the decay rates of quasinormal modes, with two numerical methods agreeing on the low-overtone spectrum.