pith. sign in

arxiv: quant-ph/9508026 · v1 · submitted 1995-08-29 · 🪐 quant-ph

Superrevivals of Rydberg Wave Packets

classification 🪐 quant-ph
keywords waverevivalpacketspackettimeinitialknownradial
0
0 comments X
read the original abstract

The revival structure and evolution of Rydberg wave packets are studied on a time scale much greater than the revival time $t_{\rm rev}$. We find a new level of revival structure and periodic motion different from that of the known fractional revivals. The new sequence of revivals culminates with the formation of a wave packet that more closely resembles the initial packet than does the full revival at time $t_{\rm rev}$. We refer to such a revival as a superrevival. We also show that an initial radial wave packet may be described as a type of squeezed state known as a radial squeezed state. Our results apply not only for hydrogenic wave packets, but for wave packets in alkali-metal atoms as well in the context of quantum defect theory.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.