Pith. sign in

REVIEW

Simulating the photometric study of pulsating white dwarf stars in the physics laboratory

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1502.01767 v1 pith:PLVTWC3W submitted 2015-02-06 astro-ph.IM

classification astro-ph.IM
keywords datadwarfstarswhiteanalysiscamerafrequencylaboratory
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

We have designed a realistic simulation of astronomical observing using a relatively low-cost commercial CCD camera and a microcontroller-based circuit that drives LEDs inside a light-tight box with time-varying intensities. As part of a laboratory experiment, students can acquire sequences of images using the camera, and then perform data analysis using a language such as MATLAB or Python to: (a) extract the intensity of the imaged LEDs, (b) perform basic calibrations on the time-series data, and (c) convert their data into the frequency domain where they can then identify the frequency structure. The primary focus is on studying light curves produced by the pulsating white dwarf stars. The exercise provides an introduction to CCD observing, a framework for teaching concepts in numerical data analysis and Fourier techniques, and connections with the physics of white dwarf stars.

Discussion (0). Continue with ORCID to comment.

Pith tools