Pith. sign in

REVIEW

Not All Attributes are Created Equal: $d_{\mathcal{X}}$-Private Mechanisms for Linear Queries

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1806.02389 v2 pith:WNNSJ6LI submitted 2018-06-06 stat.ML cs.LG

classification stat.MLcs.LG
keywords privacydatamathcalprivatelinearqueriesattributesprocedure
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
abstract

Differential privacy provides strong privacy guarantees simultaneously enabling useful insights from sensitive datasets. However, it provides the same level of protection for all elements (individuals and attributes) in the data. There are practical scenarios where some data attributes need more/less protection than others. In this paper, we consider $d_{\mathcal{X}}$-privacy, an instantiation of the privacy notion introduced in \cite{chatzikokolakis2013broadening}, which allows this flexibility by specifying a separate privacy budget for each pair of elements in the data domain. We describe a systematic procedure to tailor any existing differentially private mechanism that assumes a query set and a sensitivity vector as input into its $d_{\mathcal{X}}$-private variant, specifically focusing on linear queries. Our proposed meta procedure has broad applications as linear queries form the basis of a range of data analysis and machine learning algorithms, and the ability to define a more flexible privacy budget across the data domain results in improved privacy/utility tradeoff in these applications. We propose several $d_{\mathcal{X}}$-private mechanisms, and provide theoretical guarantees on the trade-off between utility and privacy. We also experimentally demonstrate the effectiveness of our procedure, by evaluating our proposed $d_{\mathcal{X}}$-private Laplace mechanism on both synthetic and real datasets using a set of randomly generated linear queries.

Discussion (0). Continue with ORCID to comment.

Pith tools