Pith. sign in

REVIEW 3 major objections 4 minor 40 references

Competitive and Cooperative electronic states in Ba(Fe$_{1-x}$T$_x$)$_2$As$_2$ with T=Co, Ni, Cr

T0 review · 3 major / 4 minor · reviewed 2026-08-14 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read Iron superconductor hosts a magnetic phase that aids superconductivity

desk verdict A solid comparative STM study with a new spectral category, but the headline S-shape magnetic-order claim is an unproven interpretation the authors themselves concede. read the letter →

arxiv 1908.10436 v2 pith:GK4N3Q5S submitted 2019-08-21 cond-mat.supr-con

Qiang Zou , Mingming Fu , Zhiming Wu , Li Li , David S. Parker , Athena S. Sefat , Zheng Gai This is my paper · ORCID
classification cond-mat.supr-con
keywords iron-basedsuperconductorBaFe2As2scanningtunnelingmicroscopyelectronicinhomogeneityspindensitywavemagneticimpuritystateK-meansclusteringvortexlattice
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper uses scanning tunneling microscopy and spectroscopy to compare the nanoscale electronic textures of three doped versions of the iron-pnictide superconductor BaFe2As2: cobalt-doped (superconducting), nickel-doped (superconducting and magnetic), and chromium-doped (metallic, non-superconducting). It finds that the surfaces are not electronically uniform; machine-learning clustering sorts the local spectra into a superconducting/metallic matrix plus three distinct states. The in-gap state is attributed to magnetic Co/Ni impurity atoms, the L-shape state is read as a spin density wave that competes with superconductivity, and the S-shape state, previously unreported, is proposed to be another form of magnetic order that constructively cooperates with superconductivity. The paper argues these states also act as pinning sites that stabilize the vortex lattice. A sympathetic reader would care because the S-shape state offers a real-space electronic signature for a magnetic phase that is not destroying but supporting superconductivity.

What carries the argument

The load-bearing objects are three characteristic scanning tunneling spectroscopy line shapes, sorted by K-means clustering of current-imaging tunneling spectroscopy maps: the SC/metallic matrix spectrum with coherent superconducting peaks; the in-gap state, a zero-bias peak pinned at the Fermi level; the L-shape state, an asymmetric spectrum with low residual density of states; and the S-shape state, an asymmetric spectrum tilted toward negative bias with high Fermi-level density of states. The clustering machinery converts thousands of dI/dV curves into spatial maps, allowing the volume fractions of each state to be compared across the three dopants. Supplementary density-functional calculations of the dopant atom's density of states connect the in-gap feature to Co and Ni but not Cr, while the contrast between S-shape and L-shape volume fractions across SC and non-SC samples carries the claim of cooperation versus competition.

What would settle it

Take spin-polarized STM/STS data on the same Co-122 surfaces and compare the S-shape regions' differential conductance for opposite tip magnetization directions; if no spin-dependent contrast appears, the magnetic-order assignment is contradicted. A complementary check would be to see whether the S-shape volume fraction follows the superconducting dome across a doping series—if it keeps growing while Tc falls, 'cooperative with superconductivity' is wrong.

Watch

Extended reading notes

Core claim

The central claim is that on optimally doped, superconducting Ba(Fe0.92Co0.08)2As2, underdoped Ba(Fe0.96Ni0.04)2As2 where superconductivity and antiferromagnetism coexist, and non-superconducting Ba(Fe0.96Cr0.04)2As2, the same family of nanoscale electronic inhomogeneities appears. The authors identify the in-gap state as a magnetic impurity state from Co or Ni dopants, the L-shape state as a spin density wave whose spectral asymmetry and volume fraction track competition with superconductivity, and the S-shape state, defined by an elevated density of states at the Fermi level and a spectrum tilted toward negative bias, as another magnetic order that cooperates with the superconducting state. The claim is supported by the doping-dependent volume fractions: the S-shape fraction is largest in optimally doped Co-122, barely present in non-superconducting Cr-122, and its behavior parallels a muon-spin-rotation-detected inhomogeneous magnetic component that develops constructively with superconductivity. The paper explicitly grants that the present data cannot firmly prove the S-shape state's origin and calls for spin-polarized STM.

Load-bearing premise

The S-shape spectrum is taken to be a distinct magnetic phase, but the paper admits the current data cannot firmly prove its origin; if the S-shape signature is instead a nonmagnetic impurity state or a tip artifact, the claim of a cooperative magnetic order fails.

Editorial extensions

If this is right

  • If the S-shape state is a cooperative magnetic order, then bulk superconductivity in optimally doped Co-122 coexists with a magnetic phase in real space, and pairing models must accommodate both competing and cooperating magnetic textures.
  • The residual L-shape (spin-density-wave) state in optimally doped Co-122 implies that superconductivity can survive with small patches of competing magnetic order, so 'magnetic order suppresses superconductivity' is only true in a volume-weighted sense.
  • The similar total volume fraction of inhomogeneous states across Ni, Co, and Cr dopings, set by the number of added electrons or holes, makes the dopant concentration a control parameter for engineering electronic inhomogeneity.
  • If the inhomogeneous states act as pinning centers for vortices, then the spatial arrangement of these states should influence critical currents and the upper critical field in doped 122 compounds, a consequence that could be tested by transport and magnetization measurements.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • A direct test would be spin-polarized STM: if the S-shape state is magnetic, its local tunneling conductance should depend on the tip's magnetization direction, and the magnetic contrast should vanish at temperatures above the proposed ordering scale.
  • The S-shape state may be the real-space image of the short-range cluster spin glass seen by neutron scattering in Ni-122 and of the muSR-detected magnetic component in Co-122; if so, the STM signature gives a nanoscale handle on a phase that bulk probes see only statistically.
  • Comparing the S-shape fraction across a wider doping series, including overdoped Co-122 and hole-doped Ba1-xKxFe2As2, could show whether the cooperative phase tracks the superconducting dome; that is an extension the paper does not perform.
  • The pinning argument suggests deliberately patterning dopant clusters or magnetic defects could engineer stronger vortex pinning, but that application is not explored in the paper.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 4 minor

Summary. This manuscript reports a comparative scanning tunneling microscopy/spectroscopy (STM/S) study of three doped BaFe2As2 compounds: optimally doped superconducting Co-122, underdoped Ni-122 with coexisting antiferromagnetic and superconducting order, and non-superconducting Cr-122. Using K-means clustering of current-imaging tunneling spectroscopy (CITS) data, the authors categorize the local electronic states into an in-gap state, an L-shape state, and an S-shape state, embedded in a superconducting (or metallic, for Cr-122) matrix. They argue that the in-gap state is a magnetic impurity state associated with Co/Ni dopants, supported by DFT; the L-shape state is a spin density wave (SDW) that competes with superconductivity; and the S-shape state is a distinct magnetic order that cooperates with superconductivity. They also compare vortex lattices under magnetic field and suggest that the inhomogeneous states act as pinning centers. The paper's central novelty is the S-shape state, which the authors themselves concede cannot be firmly proven from the present data and requires future spin-polarized STM measurements.

Significance. If the S-shape identification is correct, this would provide a nanoscale spectroscopic signature of a magnetic component that cooperates with, rather than competes with, superconductivity in iron-based superconductors, complementing earlier muon spin rotation studies. The use of unsupervised machine learning (K-means) to classify large STS datasets is a useful methodological contribution, and the DFT calculations provide independent support for the in-gap state assignment. The paper also offers a comparison across electron- and hole-doped compounds that is valuable for understanding doping-dependent electronic inhomogeneity. However, the central S-shape claim rests on indirect evidence—qualitative spectral shape and a volume-fraction trend across three samples—and the manuscript itself calls for spin-polarized STM to confirm the magnetic origin. The other two state identifications (in-gap, L-shape) have stronger support from prior work and DFT.

major comments (3)
  1. [Page 18, 'The S shape state' paragraph] The manuscript's central claim that the S-shape state is 'another form of magnetic order which constructively cooperates with the SC phase' is explicitly qualified on page 18: 'the present data set cannot firmly prove the origin of the phase.' This is a load-bearing gap because the S-shape identification rests entirely on qualitative spectral shape (negative-bias tilt, elevated Fermi-level DOS) and on the volume trend across the three compounds, with no direct magnetic imaging or spin-resolved measurement. The abstract and conclusion state the identification as a finding rather than as a hypothesis. I recommend either strengthening the evidence (for example, showing that the S-shape state is insensitive to tip changes, excluding nonmagnetic impurity resonances, or providing additional field-dependent signatures) or reframing the claim throughout as 'consistent with a cooperative magnetic order' pending spin-polarized STM confirmation.
  2. [Fig. 3(j) and accompanying text (page 11)] The quantitative support for the cooperative/competitive distinction is the volume fraction statistics in Fig. 3(j). These percentages are based on a single 64×64 CITS field per compound, with no reported error bars, no multiple-field statistics, and no description of how the K-means clustering was validated. The S-shape volume trend (highest in optimally doped Co-122, lowest in non-SC Cr-122) is the key evidence that the state cooperates with superconductivity; without uncertainty quantification this trend could be a sampling artifact or a tip-condition effect. The authors should provide the number of spectra per cluster, a measure of statistical spread (e.g., bootstrapping or multiple independent regions), and a robustness test of the clustering to support the claimed trend.
  3. [K-means clustering description (page 9 and Method, page 21)] The number of clusters K is a free parameter, but the manuscript does not state how K was chosen or whether the clustering was stable. This is not a purely technical issue: Fig. 2(f) shows three principal responses for Ni-122, while Fig. 3(c) shows four response types (including L-shape) for the same compound. If K was set differently for different datasets, the classification of S- and L-shape states as distinct entities is not robust, and the subsequent volume comparisons are compromised. The authors should report the K selection procedure (e.g., silhouette or elbow analysis) and demonstrate stability of the cluster assignments with repeated runs or subsampling.
minor comments (4)
  1. [Fig. 2(f) vs Fig. 3(c)] Please clarify whether the K-means analysis in Fig. 2 used K=3 or K=4; the text says 'three principal responses' but later introduces L-shape as one of the four categories in Fig. 3.
  2. [Page 16, 'The vortex matter...' paragraph] The claim that the inhomogeneous states serve as pinning centers is based on comparing the global vortex lattice behavior of Ni-122 and Co-122, but no direct spatial correlation between vortex positions and the cluster map (S/L/in-gap positions) is shown. An overlay of vortex cores on the corresponding cluster map would strengthen this inference.
  3. [Abstract] The abstract states 'Machine learning method is utilized' without specifying the method as K-means unsupervised clustering; adding this detail would improve precision and reproducibility.
  4. [Page 20, Method section] There is a typographical spacing error in 'dI/dV . Line spectroscopies'—the period should be attached to 'dI/dV'.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: unsupervised K-means classification, in-paper DFT, and external references support the central claims; the S-shape origin is explicitly left open.

full rationale

The paper's load-bearing derivations do not reduce to their inputs. The three spectral families are obtained by an unsupervised K-means algorithm, as stated in the Methods: 'The analysis uses an unsupervised learning algorithm, with the goal to find groups in the data.' The categories are therefore not constructed from the paper's conclusions. The in-gap assignment is supported in-paper by DFT (Fig. 4) showing a near-Fermi dopant DOS for Co and Ni but not Cr, plus the observation that the zero-energy feature is never seen in Cr-122; the prior self-citation (ref 25) is corroborated rather than load-bearing. The L-shape-to-SDW identification is taken from external studies (refs 20 and 23) and applied to the present spectra; no equation defines the L-shape as SDW by construction. The S-shape-to-cooperative-magnetic-order claim is explicitly tentative: 'the present data set cannot firmly prove the origin of the phase' and 'we anticipate it is another form of magnetic state,' with 'Future spin-polarized STM studies are essential to further confirm and identify the relation.' That is an evidentiary limitation, not a circular reduction. The vortex-flux result, (1.96±0.4)×10^-15 Tm2 versus Phi0 = 2.07×10^-15 Tm2, is a consistency check against an independent constant. The statement that the total volume fraction is coincident with doping is an observed comparison, not a fitted identity. There is no fitted parameter renamed as a prediction, no uniqueness theorem imported from the authors' own prior work, and no ansatz smuggled in by citation. The central S-shape claim is underdetermined and would require spin-polarized STM, but underdetermination is not circularity.

Assumptions & free parameters 1 free parameters · 5 assumptions · 1 invented entities

The central interpretation of S-shape as cooperative magnetic order rests on a new spectral classification rather than on a parameter-free derivation. No fitted constants are used beyond the user-chosen cluster count. The listed assumptions are standard STM and clustering assumptions plus transfer of prior SDW identification.

free parameters (1)
  • K-means cluster number K = Not explicitly reported; inferred as 4 for Ni-122 and Co-122, 3 for Cr-122
    K is chosen by the user in K-means and is not justified by an objective criterion; it directly determines how many distinct electronic states are separated.
assumptions (5)
  • domain assumption dI/dV spectra are proportional to the local density of states.
    The entire spectral classification treats STS signal as LDOS; this is standard STM practice but not independently verified in the paper.
  • domain assumption K-means clustering with a user-chosen K partitions the spectral dataset into physically meaningful states.
    The choice of K determines which states are separated, and no validation metric is provided.
  • domain assumption Spectral shapes are intrinsic to the electronic phases and are not dominated by surface reconstruction or tip artifacts.
    The paper argues against topography correlation but does not eliminate all extrinsic contributions.
  • domain assumption The L-shape spectrum is a spin-density-wave signature established in NaFe1-xCoxAs, and this identification transfers to Ba122.
    The paper relies on refs 20 and 23 for the SDW interpretation rather than providing direct magnetic imaging.
  • domain assumption DFT calculations with one dopant per 32 Fe atoms adequately represent the local impurity DOS relevant to STM.
    The calculations support the in-gap interpretation but ignore disorder and superconducting coherence.
invented entities (1)
  • S-shape electronic state
    purpose: Proposed as a distinct magnetic order that cooperates with superconductivity rather than competing with it.
    No direct magnetic probe is provided; the paper states it cannot firmly prove the origin and calls for future spin-polarized STM.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Competitive and Cooperative electronic states in Ba(Fe$_{1-x}$T$_x$)$_2$As$_2$ with T=Co, Ni, Cr." pith.science (2026). https://pith.science/paper/GK4N3Q5S

@misc{pith2026190810436,
  author       = {Pith},
  title        = {Pith review of: Competitive and Cooperative electronic states in Ba(Fe$_1-x$T$_x$)$_2$As$_2$ with T=Co, Ni, Cr},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/GK4N3Q5S}},
  note         = {Machine review of arXiv:1908.10436}
}
read the original abstract

The electronic structure inhomogeneities in Co, Ni, and Cr doped BaFe2As2 122 single crystals are compared using scanning tunneling microscopy/spectroscopy (STM/S) at the nanoscale within three bulk property regions in the phase diagram: a pure superconducting (SC) dome region (Co-122), a coexisting SC and antiferromagnetic (AFM) region (Ni-122), and a non-SC region (Cr-122). Machine learning is utilized to categorize the various nanometer scale inhomogeneous electronic states, described here as in-gap, L-shape and S-shape states immersed into the SC matrix for Ni-and Co-doped 122, and L-shape and S-shape states into the metallic matrix for Cr-doped 122. Although the relative percentages of in-gap, L-shape and S-shape states vary in the three samples, the total volume fraction of the three electronic states is quite similar. This is coincident with the number of electrons (Ni0.04 and Co0.08) and holes (Cr0.04) doped into the 122 compound. By combining the volume fractions of the three states, the local density of states (LDOS), magnetic field dependent behavior and global properties in these three samples, the in-gap state is confirmed as a magnetic impurity state from the Co or Ni dopants. In addition, the L-shape state is identified as a spin density wave (SDW) which competes with the SC phase, and the S-shape state is found to be another form of magnetic order which constructively cooperates with the SC phase, rather than competing with it. The comparison of the vortex structures indicates that the inhomogeneous electronic states serve as pinning centers for stabilizing the vortex lattice.

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

40 extracted references · 40 canonical work pages

  1. [1]

    A.; Nagaosa, N.; Wen, X

    Lee, P. A.; Nagaosa, N.; Wen, X. -G., Doping a Mott insulator: Physics of high -temperature superconductivity. Reviews of Modern Physics 2006, 78 (1), 17-85

    work page 2006

  2. [2]

    Reviews of Modern Physics 2015, 87 (3), 855-896

    Dai, P., Antiferromagnetic order and spin dynamics in iron -based superconductors. Reviews of Modern Physics 2015, 87 (3), 855-896

    work page 2015

  3. [3]

    the volume percentage of the S state is lowest in non-SC Cr-122, and highest in optimum doped Co-122. Notably, from the volumes of the S state of the three compounds , the behavior of the S shape state is more cooperative with the superconducting state, rather than competitive with SC as observed for the L shape state. This abnormal behavior and the highl...

    work page

  4. [4]

    J., A common thread: The pairing interaction for unconventional superconductors

    Scalapino, D. J., A common thread: The pairing interaction for unconventional superconductors. Reviews of Modern Physics 2012, 84 (4), 1383-1417

    work page 2012

  5. [5]

    C.; Kirtley, J

    Tsuei, C. C.; Kirtley, J. R., Pairing symmetry in cuprate superconductors. Reviews of Modern Physics 2000, 72 (4), 969-1016

    work page 2000

  6. [6]

    M.; He, R.-H.; Devereaux, T

    Hashimoto, M.; Vishik, I. M.; He, R.-H.; Devereaux, T. P.; Shen, Z.-X., Energy gaps in high-transition- temperature cuprate superconductors. Nature Physics 2014, 10, 483

    work page 2014

  7. [7]

    Annual Review of Condensed Matter Physics 2012, 3 (1), 57-92

    Chubukov, A., Pairing Mechanism in Fe -Based Superconductors. Annual Review of Condensed Matter Physics 2012, 3 (1), 57-92

    work page 2012

  8. [8]

    R., Anomalous Scaling Relations and Pairing Mechanism of the Fe -based Superconductors

    Bang, Y.; St ewart, G. R., Anomalous Scaling Relations and Pairing Mechanism of the Fe -based Superconductors. Journal of Physics: Conference Series 2017, 807, 052003

    work page 2017

Show all 40 references
  1. [9]

    -H., The Electron -Pairing Mechanism of Iron -Based Superconductors

    Wang, F.; Lee, D. -H., The Electron -Pairing Mechanism of Iron -Based Superconductors. Science 2011, 332 (6026), 200. 22

    2011

  2. [10]

    Phys Rev Lett 2008, 101 (10), 107006

    Rotter, M.; Tegel, M.; Johrendt, D., Superconductivity at 38 K in the iron arsenide (Ba1-xKx)Fe2As2. Phys Rev Lett 2008, 101 (10), 107006

    2008

  3. [11]

    S.; Singh, D

    Sefat, A. S.; Singh, D. J.; Jin, R. Y.; McGuire, M. A.; Sales, B. C.; Ronning, F.; Mandrus, D., BaT2As2 single crystals (T = Fe, Co, Ni) and superconductivity upon Co-doping. Physica C 2009, 469 (9-12), 350-354

    2009

  4. [12]

    E., Monolayer FeSe on SrTiO3

    Huang, D.; Hoffman, J. E., Monolayer FeSe on SrTiO3. Annual Review of Condensed Matter Physics 2017, 8 (1), 311-336

    2017

  5. [13]

    F.; Wang, C.; Ren, Z.; Feng, C

    Jiang, S.; Xing, H.; Xuan, G. F.; Wang, C.; Ren, Z.; Feng, C. M.; Dai, J. H.; Xu, Z. A.; Cao, G. H., Superconductivity up to 30 K in the vicinity of the quantum critical point in BaFe2(As1 -xPx)(2). J Phys- Condens Mat 2009, 21 (38), 382203

    2009

  6. [14]

    S.; Singh, D

    Sefat, A. S.; Singh, D. J.; VanBebber, L. H.; Mozharivskyj, Y.; McGuire, M. A.; Jin, R. Y.; Sales, B. C.; Keppens, V.; Mandrus, D., Absence of superconductivity in hole-doped BaFe2-xCrxAs2 single crystals. Phys Rev B 2009, 79 (22), 224524

    2009

  7. [15]

    Y.; Tam, D

    Lu, X. Y.; Tam, D. W.; Zhang, C. L.; Luo, H. Q.; Wang, M.; Zhang, R.; Harriger, L. W.; Keller, T.; Keimer, B.; Regnault, L. P.; Maier, T. A.; Dai, P. C., Short-range cluster spin glass near optimal superconductivity in BaFe2-xNixAs2. Phys Rev B 2014, 90 (2), 024509

    2014

  8. [16]

    H., Functional Renormalization-Group Study of the Pairing Symmetry and Pairing Mechanism of the FeAs-Based High-Temperature Superconductor

    Wang, F.; Zhai, H.; Ran, Y.; Vishwanath, A.; Lee, D. H., Functional Renormalization-Group Study of the Pairing Symmetry and Pairing Mechanism of the FeAs-Based High-Temperature Superconductor. Phys Rev Lett 2009, 102 (4), 047005

    2009

  9. [17]

    M.; Abrahams, E., Strong correlations and magnetic frustration in the high T(c) iron pnictides

    Si, Q. M.; Abrahams, E., Strong correlations and magnetic frustration in the high T(c) iron pnictides. Phys Rev Lett 2008, 101 (7), 076401

    2008

  10. [18]

    K.; Kim, M

    Pratt, D. K.; Kim, M. G.; Kreyssig, A.; Lee, Y. B.; Tucker, G. S.; Thaler, A.; Tian, W.; Zarestky, J. L.; Bud'ko, S. L.; Canfield, P. C.; Ha rmon, B. N.; Goldman, A. I.; McQueeney, R. J., Incommensurate Spin - Density Wave Order in Electron-Doped BaFe2As2 Superconductors. Phys...

    2011

  11. [19]

    Th is model was used to explain the scanning tunneling microscopic observation of the coexistence as well as co-disappearance of pseudogap-like feature and superconductor in NaFe 1- xCoxAs (Co-111) system where the pure itinerant picture fails 20. A muon spin rotation study al...

  12. [20]

    D.; Cai, P.; Wang, A

    Zhou, X. D.; Cai, P.; Wang, A. F.; Ruan, W.; Ye, C.; Chen, X. H.; You, Y. Z.; Weng, Z. Y.; Wang, Y. Y., Evolution from Unconventional Spin Density Wave to Superconductivity and a Pseudogaplike Phase in NaFe1-xCoxAs. Phys Rev Lett 2012, 109 (3), 037002

    2012

  13. [21]

    P.; Li, T.; Weng, Z

    Kou, S. P.; Li, T.; Weng, Z. Y., Coexistence of itinerant electrons and local moments in iron -based superconductors. Epl-Europhys Lett 2009, 88 (1), 17010

    2009

  14. [22]

    Z.; Yang, F.; Kou, S

    You, Y. Z.; Yang, F.; Kou, S. P.; Weng, Z. Y., Magnetic and superconducting instabilities in a hybrid model of itinerant/localized electrons for iron pnictides. Phys Rev B 2011, 84 (5), 054527

    2011

  15. [23]

    D.; Ruan, W.; Wang, A

    Cai, P.; Zhou, X. D.; Ruan, W.; Wang, A. F.; Chen, X. H.; Lee, D. H.; Wang, Y. Y., Visualizing the microscopic coexistence of spin density wave and superconductivity in underdoped NaFe1 -xCoxAs. Nat Commun 2013, 4, 1596

    2013

  16. [24]

    N.; Nuccio, L.; Schulz, L.; Zaharko, O.; Larsen, J.; Aristizabal, C.; Willis, M.; Drew, A

    Bernhard, C.; Wang, C. N.; Nuccio, L.; Schulz, L.; Zaharko, O.; Larsen, J.; Aristizabal, C.; Willis, M.; Drew, A. J .; Varma, G. D.; Wolf, T.; Niedermayer, C., Muon spin rotation study of magnetism and superconductivity in Ba(Fe1-xCox)(2)As-2 single crystals. Phys Rev B 2012, ...

    2012

  17. [25]

    J.; Schulz, L.; Malik, V

    Bernhard, C.; Drew, A. J.; Schulz, L.; Malik, V. K.; Rossle, M.; Niedermayer, C.; Wolf, T.; Varma, G. D.; Mu, G.; Wen, H. H.; Liu, H.; Wu, G.; Chen, X. H., Muon spin rotation study of magnetism and superconductivity in BaFe2-xCoxAs2 and Pr1-xSrxFeAsO. New J Phys 2009, 11, 055050

    2009

  18. [26]

    R.; Jesse, S.; Laanait, N., Pycroscopy - An Open Source Approach to Microscopy and Microanalysis in the Age of Big Data and Open Science

    Somnath, S.; Smith, C. R.; Jesse, S.; Laanait, N., Pycroscopy - An Open Source Approach to Microscopy and Microanalysis in the Age of Big Data and Open Science. Microscopy and Microanalysis 2017, 23 (S1), 224-225

    2017

  19. [27]

    S., Bulk synthesis of iron -based superconductors

    Sefat, A. S., Bulk synthesis of iron -based superconductors. Curr Opin Solid St M 2013, 17 (2), 59- 64

    2013

  20. [28]

    M.; Fu, M

    Zou, Q.; Wu, Z. M.; Fu, M. M.; Zhang, C. M.; Rajput, S.; Wu, Y. P.; Li, L.; Parker, D. S.; Kang, J.; Sefat, A. S.; Gai, Z., Effect of Surface Morphology and Magnetic Impurities on the Electronic Structure in Cobalt- Doped BaFe2As2 Superconductors. Nano Lett 2017, 17 (3), 1642-1647. 23

    2017

  21. [29]

    Q.; Kracher, A.; Colombier, E.; Bud'ko, S

    Ni, N.; Thaler, A.; Yan, J. Q.; Kracher, A.; Colombier, E.; Bud'ko, S. L.; Canfield, P. C.; Hannahs, S. T., Temperature versus doping phase diagrams for Ba(Fe1 -xTMx)(2)As-2(TM=Ni,Cu,Cu/Co) single crystals. Phys Rev B 2010, 82 (2), 024519

    2010

  22. [30]

    E., Spectroscopic scanning tunneling microscopy insights into Fe -based superconductors

    Hoffman, J. E., Spectroscopic scanning tunneling microscopy insights into Fe -based superconductors. Rep Prog Phys 2011, 74 (12), 124513

    2011

  23. [31]

    C.; Bud'ko, S

    Canfield, P. C.; Bud'ko, S. L.; Ni, N.; Yan, J. Q.; Kracher, A., Decoupling of the superconducting and magnetic/structural phase transitions in electron-doped BaFe2As2. Phys Rev B 2009, 80 (6), 060501(R)

    2009

  24. [32]

    Phys Rev B 2012, 85 (21), 214505

    Hanaguri, T.; Kitagawa, K.; Matsubayashi, K.; Mazaki, Y.; Uwatoko, Y.; Takagi, H., Scanning tunneling microscopy/spectroscopy of vortices in LiFeAs. Phys Rev B 2012, 85 (21), 214505

    2012

  25. [33]

    H.; Garber, W.; Ku, W., Do Transition-Metal Substitutions Dope Carriers in Iron- Based Superconductors? Phys Rev Lett 2012, 108 (20), 207003

    Berlijn, T.; Lin, C. H.; Garber, W.; Ku, W., Do Transition-Metal Substitutions Dope Carriers in Iron- Based Superconductors? Phys Rev Lett 2012, 108 (20), 207003

    2012

  26. [34]

    H.; Hudson, E

    Pan, S. H.; Hudson, E. W.; Gupta, A. K.; Ng, K. W.; Eisaki, H.; Uchida, S.; Davis, J. C., STM studies of the electronic structure of vortex cores in Bi2Sr2CaCu2O8+delta. Phys Rev Lett 2000, 85 (7), 1536-1539

    2000

  27. [35]

    Nature Physics 2015, 11 (7), 543

    Yin, J.; Wu, Z.; Wang, J.; Ye, Z.; Gong, J.; Hou, X.; Shan, L.; Li, A.; Liang, X.; Wu, X., Observation of a robust zero-energy bound state in iron-based superconductor Fe (Te, Se). Nature Physics 2015, 11 (7), 543

    2015

  28. [36]

    L.; Wang, X

    Yin, Y.; Zech, M.; Williams, T. L.; Wang, X. F.; Wu, G.; Chen, X. H.; Hoffman, J. E., Scanning tunneling spectroscopy and vortex imaging in the iron pnictide superconductor BaFe1.8Co0.2As2. Phys Rev Lett 2009, 102 (9), 097002

    2009

  29. [37]

    L.; Shen, B.; Zeng, B.; Huang, Y.; Li, A.; Wang, D.; Yang, H

    Shan, L.; Wang, Y. L.; Shen, B.; Zeng, B.; Huang, Y.; Li, A.; Wang, D.; Yang, H. A.; Ren, C.; Wang, Q. H.; Pan, S. H. H.; Wen, H. H., Observation of ordered vortices with Andreev bound states in Ba0.6K0.4Fe2As2. Nature Physics 2011, 7 (4), 325-331

    2011

  30. [39]

    -P.; Chen, X., Phase separation and magnetic order in K-doped iron selenide superconductor

    Li, W.; Ding, H.; Deng, P.; Chang, K.; Song, C.; He, K.; Wang, L.; Ma, X.; Hu, J. -P.; Chen, X., Phase separation and magnetic order in K-doped iron selenide superconductor. Nature Physics 2012, 8 (2), 126

    2012

  31. [40]

    N.; Hirschfeld, P

    Gastiasoro, M. N.; Hirschfeld, P. J.; Andersen, B. M., Impurity states and cooperative magnetic order in Fe-based superconductors. Phys Rev B 2013, 88 (22), 220509(R)

    2013

  32. [111]

    FeSC. In our current comparison experiment of 122 system, we further found that 1) the SDW spectrum exists in both electron and hole doped 122 compounds; 2) the SDW survives even in the 18 optimal doped Co -122 crystals , altho ugh the volume is very small (2.3%) ; 3) the high...

Pith tools

Reviewed August 14, 2026 · model on record in the stance chip above.