Pith. sign in

REVIEW

Energy Efficiency Optimization for Downlink Massive MIMO With Statistical CSIT

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2002.04888 v1 pith:NOEVHNXQ submitted 2020-02-12 cs.IT eess.SPmath.IT

classification cs.ITeess.SPmath.IT
keywords optimizationdownlinkefficiencyenergymassivemimoproblemstatistical
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

We investigate energy efficiency (EE) optimization for single-cell massive multiple-input multiple-output (MIMO) downlink transmission with only statistical channel state information (CSI) available at the base station. We first show that beam domain transmission is favorable for energy efficiency in the massive MIMO downlink, by deriving a closed-form solution for the eigenvectors of the optimal transmit covariance matrix. With this conclusion, the EE optimization problem is reduced to a real-valued power allocation problem, which is much easier to tackle than the original large-dimensional complex matrix-valued precoding design problem. We further propose an iterative water-filling-structured beam domain power allocation algorithm with low complexity and guaranteed convergence, exploiting the techniques from sequential optimization, fractional optimization, and random matrix theory. Numerical results demonstrate the near-optimal performance of our proposed statistical CSI aided EE optimization approach.

Discussion (0). Continue with ORCID to comment.

Pith tools