Pith. sign in

REVIEW

MLPerf Mobile Inference Benchmark

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2012.02328 v4 pith:EKW5UW2G submitted 2020-12-03 cs.LG cs.DC

classification cs.LGcs.DC
keywords mobilebenchmarkdatadevicesdifferentfirstmlperfmodels
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

This paper presents the first industry-standard open-source machine learning (ML) benchmark to allow perfor mance and accuracy evaluation of mobile devices with different AI chips and software stacks. The benchmark draws from the expertise of leading mobile-SoC vendors, ML-framework providers, and model producers. It comprises a suite of models that operate with standard data sets, quality metrics and run rules. We describe the design and implementation of this domain-specific ML benchmark. The current benchmark version comes as a mobile app for different computer vision and natural language processing tasks. The benchmark also supports non-smartphone devices, such as laptops and mobile PCs. Benchmark results from the first two rounds reveal the overwhelming complexity of the underlying mobile ML system stack, emphasizing the need for transparency in mobile ML performance analysis. The results also show that the strides being made all through the ML stack improve performance. Within six months, offline throughput improved by 3x, while latency reduced by as much as 12x. ML is an evolving field with changing use cases, models, data sets and quality targets. MLPerf Mobile will evolve and serve as an open-source community framework to guide research and innovation for mobile AI.

Discussion (0). Continue with ORCID to comment.

Pith tools