Pith. sign in

REVIEW 2 cited by

AlphaFin: Benchmarking Financial Analysis with Retrieval-Augmented Stock-Chain Framework

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2403.12582 v1 pith:2VDVGKH3 submitted 2024-03-19 cs.CL

classification cs.CL
keywords financialanalysisdatasetsalphafinllmsdataframeworkgeneration
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

The task of financial analysis primarily encompasses two key areas: stock trend prediction and the corresponding financial question answering. Currently, machine learning and deep learning algorithms (ML&DL) have been widely applied for stock trend predictions, leading to significant progress. However, these methods fail to provide reasons for predictions, lacking interpretability and reasoning processes. Also, they can not integrate textual information such as financial news or reports. Meanwhile, large language models (LLMs) have remarkable textual understanding and generation ability. But due to the scarcity of financial training datasets and limited integration with real-time knowledge, LLMs still suffer from hallucinations and are unable to keep up with the latest information. To tackle these challenges, we first release AlphaFin datasets, combining traditional research datasets, real-time financial data, and handwritten chain-of-thought (CoT) data. It has a positive impact on training LLMs for completing financial analysis. We then use AlphaFin datasets to benchmark a state-of-the-art method, called Stock-Chain, for effectively tackling the financial analysis task, which integrates retrieval-augmented generation (RAG) techniques. Extensive experiments are conducted to demonstrate the effectiveness of our framework on financial analysis.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Agentar-Fin-R1: Enhancing Financial Intelligence through Domain Expertise, Training Efficiency, and Advanced Reasoning

    cs.CL 2025-07 conditional novelty 5.0 of 10

    Agentar-Fin-R1, an 8B and 32B financial LLM family, reports top scores on FinEval, FinanceIQ, and a new Finova benchmark while keeping general reasoning near its Qwen3 base.

  2. Integrating Large Language Models in Financial Investments and Market Analysis: A Survey

    q-fin.GN 2025-06 conditional novelty 1.0 of 10

    A survey that organizes recent LLM-in-finance research into four framework categories and summarizes the reported methods, datasets, and performance of about 30 systems.

Pith tools