Pith. sign in

REVIEW 1 cited by

From Generalist to Specialist: Adapting Vision Language Models via Task-Specific Visual Instruction Tuning

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2410.06456 v1 pith:ALITAD7I submitted 2024-10-09 cs.CV

classification cs.CV
keywords modelstask-specificvlmsvitasklanguageresponsetsmstuning
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Large vision language models (VLMs) combine large language models with vision encoders, demonstrating promise across various tasks. However, they often underperform in task-specific applications due to domain gaps between pre-training and fine-tuning. We introduce VITask, a novel framework that enhances task-specific adaptability of VLMs by integrating task-specific models (TSMs). VITask employs three key strategies: exemplar prompting (EP), response distribution alignment (RDA), and contrastive response tuning (CRT) to improve the task-specific performance of VLMs by adjusting their response distributions. EP allows TSM features to guide VLMs, while RDA enables VLMs to adapt without TSMs during inference by learning from exemplar-prompted models. CRT further optimizes the ranking of correct image-response pairs, thereby reducing the risk of generating undesired responses. Experiments on 12 medical diagnosis datasets across 9 imaging modalities show that VITask outperforms both vanilla instruction-tuned VLMs and TSMs, showcasing its ability to integrate complementary features from both models effectively. Additionally, VITask offers practical advantages such as flexible TSM integration and robustness to incomplete instructions, making it a versatile and efficient solution for task-specific VLM tuning. Our code are available at https://github.com/baiyang4/VITask.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Advantage-Guided Gate: Reshaping Open-Ended Reasoning for Vision-Based Spatial Intelligence

    cs.CV 2026-08 conditional novelty 5.0 of 10

    A learned advantage gate, trained on Monte Carlo reasoning trees, improves MLLM spatial reasoning accuracy by filtering intermediate steps and reranking candidate answers.

Pith tools