Pith. sign in

REVIEW 2 major objections 5 minor 21 references

Lorentz Transformation of the Energy Spectrum of the Equilibrium State of Massive Free Fields

T0 review · 2 major / 5 minor · reviewed 2026-08-10 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read Massive equilibrium fields cannot be assigned a scalar temperature by a moving observer

desk verdict A clean derivation of massive free-field spectra that correctly shows scalar temperature fails for massive fields, but the 'always necessary' claim overreaches beyond the unitary-transformed global-Gibbs convention. read the letter →

arxiv 2412.20817 v1 pith:WJ2LF5TH submitted 2024-12-30 cond-mat.stat-mech

Ruohan Xu , Tingzhang Shi , H. T. Quan This is my paper · ORCID
classification cond-mat.stat-mech MSC 82B3083A0582B10 PACS 05.30.-d05.70.-a03.30.+p
keywords relativisticthermodynamicsfour-vectortemperatureLorentztransformationspectraldensitymassivefreefieldsblackbodyradiationcosmicneutrinobackground
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper argues that the familiar scalar temperature of a moving thermal body is a special case that only works for massless particles. For a massive free field in equilibrium, the spectral density seen by a moving observer depends on energy and direction through the Lorentz-invariant contraction of a four-vector inverse temperature with the particle four-momentum, so no single effective temperature per direction can reproduce the spectrum. The paper derives explicit bosonic and fermionic spectral densities, shows they reduce to the known blackbody transformation in the massless limit, and concludes that a four-vector temperature is required for a covariant description of thermal equilibrium. This matters because it changes how relativistic equilibrium states, including a massive cosmic neutrino background, should be described.

What carries the argument

The load-bearing object is the covariant spectral density $\rho(\omega,\hat{k}) = g_s\,\omega^2\sqrt{\omega^2-m^2}\,[2(2\pi)^3]^{-1}\coth[(\beta_\mu P^\mu - \alpha)/2]$ (bosons) and its $-$tanh fermionic counterpart, built from the four-vector inverse temperature $\beta_\mu = \beta u_\mu$ and the on-shell four-momentum $P^\mu = (\omega, \hat{k}\sqrt{\omega^2-m^2})$. The argument's work is done by the Lorentz-invariant contraction $\beta_\mu P^\mu$: when $m=0$ this contraction is exactly proportional to $\omega$, allowing an effective scalar temperature $T/\gamma(1+v\cdot\hat{k})$ to absorb all the motion dependence; when $m\neq0$ the relation $|k| = \sqrt{\omega^2-m^2}$ breaks that proportionality, making the spectral shape depend on $\omega$ in a way no direction-dependent scalar can mimic.

What would settle it

Measure the energy spectrum of a thermal gas of massive particles, or a massive relic background, from a frame moving relative to it. The scalar-temperature claim predicts that the spectrum in a fixed direction is a Planck-like function of $\omega'/T'(\hat{k}')$; the paper predicts an additional $\omega'$-dependent factor $\sqrt{1-(m/\omega')^2}$ inside the occupation argument. A spectrum in a fixed direction that has the one-parameter Planck form for massive particles would refute the claim, while a spectrum that requires the extra mass-dependent argument would support it.

Watch

Extended reading notes

Core claim

The paper's central discovery is that the equilibrium energy spectrum of a free massive field, as seen by an observer moving with velocity $v$, is characterized by the covariant spectral density $$\rho(\omega',\hat{k}') = g_s\,\frac{\omega'^2\sqrt{\omega'^2-$m^{2}$}}{2(2\pi)^3}\, \coth\!\left(\frac{\$\beta$\gamma(\omega' + v\cdot\hat{k}'\sqrt{\omega'^2-$m^{2}$}) - \$\alpha$}{2}\right)$$ for bosons, with $\coth$ replaced by $-\tanh$ for fermions. The argument of the occupation factor is $\beta'_\mu P'^{\mu} = \beta\gamma(\omega' + v\cdot \hat{k}'\sqrt{\omega'^2 - m^2})$. In the massless limit $m=0$, the contraction is proportional to $\omega'$ and the spectrum is a Planck-like function with a direction-dependent scalar temperature; for $m\neq0$, the ratio $\omega'/\beta'_\mu P'^{\mu}$ depends on $\omega'$ itself, so a scalar temperature, even one with dipole anisotropy, is insufficient. The authors conclude that the four-vector inverse temperature $\beta_\mu = \beta u_\mu$ is the correct covariant characterization of a moving equilibrium state.

Load-bearing premise

The paper assumes the equilibrium state is the global thermal state in the field's rest frame and that the moving observer's state is its unitary Lorentz transform, with no extra boundary conditions; if a moving system's equilibrium is defined differently, the spectrum could change.

Editorial extensions

If this is right

  • A moving observer of a massive equilibrium field will see a spectrum whose shape changes with energy, not just with direction; the extra distortion grows as $m/\omega'$ becomes non-negligible.
  • The cosmic neutrino background, if neutrinos have non-negligible rest mass, must be described by a four-vector temperature; its spectrum will not be fit by a single dipole-shifted scalar temperature.
  • The massless photon case is a limiting case of the same formula: the derivation recovers the known transformation of blackbody radiation as $m\to0$, which is why the CMB dipole temperature works only because photons are massless.
  • Two systems with the same rest temperature and chemical potential but different velocities are not mutually in equilibrium; equality of the four-vector temperature and the chemical potential is the necessary and sufficient condition for identical spectra.
  • In the classical nonrelativistic limit the bosonic spectrum reduces to a shifted Maxwellian and the fermionic spectrum to a shifted Fermi surface, confirming consistency with nonrelativistic statistical mechanics.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If the claim holds, a laboratory test with a thermal gas of massive particles observed from a moving frame should reveal the predicted energy-dependent spectral distortion whenever $m/\omega'$ is not tiny; an experiment that sees only a direction-dependent temperature in that regime would challenge the paper's conclusion.
  • The same covariant spectral-density construction could be extended to interacting fields or to systems with additional conserved charges, since the paper's generalized Gibbs form already allows arbitrary Poincare-invariant conserved charges, though the free-field assumption would need re-examination.
  • A practical implication the authors leave implicit is that velocity estimates extracted from a massive relic background by fitting a scalar dipole temperature would be biased, because the assumed spectral form would be wrong for $m\neq0$.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

2 major / 5 minor

Summary. The paper considers a massive free scalar (bosonic) field and a Majorana (fermionic) field in a global equilibrium state in their rest frame, and computes the energy spectral density as seen by a uniformly moving inertial observer. The central result is a covariant formula, Eq. (20) for bosons and Eq. (21) for fermions, in which the thermal factor depends on the four-vector temperature beta_mu = beta u_mu through beta_mu P^mu. In the massless limit the bosonic result reduces to the known moving blackbody spectrum with a direction-dependent effective temperature, Eq. (15); for massive fields the ratio omega'/(beta'_mu P'^mu) depends on omega' as well as on direction, so no scalar temperature can describe the moving spectrum. The paper also discusses the classical and non-relativistic limits and the complex-scalar case with a conserved U(1) charge.

Significance. The bosonic derivation is clean and internally consistent; I verified the factors in Eqs. (7), (9), (14), and (16) from the invariant measure, and the massless limit reproduces the earlier blackbody transformation of Ford and O'Connell. The main conceptual point, that the CMB's scalar-temperature dipole description is an accident of massless photons and fails for massive fields, is a useful clarification, and the covariant spectral formulas could be relevant for the cosmic neutrino background. A strength of the paper is that the derivation is explicit and fully checkable from the stated assumptions. The main limitations are that the 'always necessary' claim in the abstract and in Sec. III.D is broader than the free-field, global-equilibrium setup actually treated, and that the fermionic appendix contains an incorrect operator expectation value, although the final fermionic formula is correct.

major comments (2)
  1. [Sec. III.D and Abstract] The final sentence of Sec. III.D, 'Therefore the four-vector temperature is always necessary in the relativistic thermodynamics,' and the corresponding wording in the Abstract overstate the scope of the derivation. The calculation assumes non-interacting free fields and defines the moving observer's state as rho' = U(Lambda) rho U(Lambda)^dagger with rho the global grand canonical ensemble in the system rest frame, Eq. (10). Under other commonly discussed conventions for a moving equilibrium state, for example a Gibbs state built from the observer-frame Hamiltonian or a system enclosed in a cavity at rest with the observer, the spectral density is not Eq. (16) and the conclusion need not follow. I recommend restricting the universality claim to the free-field, global-equilibrium (van Kampen) convention and removing 'always' from the abstract.
  2. [Appendix A, Eq. (A3)] The first expectation value in Eq. (A3) is not correct as printed. For the fermionic Hamiltonian of Eq. (A2), the anti-commutation relation gives b b^dagger + b^dagger b = delta^*(k-k') for matching spin, so the thermal expectation value of that combination is delta^*, independent of temperature, not -delta^* tanh((beta omega - alpha)/2). The combination that actually enters the energy density is -b b^dagger + b^dagger b, whose expectation value is -delta^* tanh((beta omega - alpha)/2). The calculation in Eq. (A4) carries an extra overall minus sign and thereby produces the correct final spectral density, Eq. (17), but the identity stated in Eq. (A3) is wrong and should be repaired because it is a load-bearing step in the fermionic derivation.
minor comments (5)
  1. [Eqs. (1) and (31)] The Lagrangians in Eqs. (1) and (31) have a plus sign in the mass term. With the metric eta = diag(1,-1,-1,-1), the correct massive scalar Lagrangian is L = 1/2 partial_mu phi partial^mu phi - (1/2) m^2 phi^2, since the plus sign gives the tachyonic equation of motion (box - m^2) phi = 0, inconsistent with the dispersion omega = sqrt(k^2 + m^2) used throughout the paper. The derivation itself does not rely on the Lagrangian, but the setup equation should be corrected.
  2. [Eq. (22) and Sec. II.C] The direction k-circumflex' is defined as the unit vector along the wave vector k, but in the text it is also called the 'direction of observation.' Since the photon momentum points opposite to the line of sight, this wording invites a sign error in the dipole formula. Please state explicitly that k-circumflex' is the photon propagation direction, not the direction from the observer to the source.
  3. [Sec. III.A and Eq. (15)] The moving massless spectrum is described as a 'perfect black body spectrum' and a scalar temperature with dipole anisotropy. The displayed coth form in Eq. (15) contains the zero-point contribution, so the blackbody identification is exact only after subtracting the zero-point term. The wording should be qualified as an energy spectrum of the zero-point-subtracted blackbody part.
  4. [Sec. IV (CnuB remark)] The statement that the thermal fluctuation is comparable to the rest energy of neutrinos appears inconsistent with the numbers given: a temperature of 1.95 K corresponds to about 1.7 x 10^-4 eV, while the neutrino masses quoted are 10^-2 to 10^-1 eV. Please check this comparison or rephrase the intended point.
  5. [Throughout] There are several typographical issues: 'Plank' should be 'Planck', 'tmepera-ture' should be 'temperature', 'Equili brium' in the title has an unnecessary space, and 'Half a century latter' should be 'Half a century later'. Please also check reference [21], which is only a URL, for completeness.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: the moving-frame spectrum is derived from the rest-frame Gibbs state and a unitary Lorentz transformation, and the four-vector temperature is introduced after the fact as a covariant packaging of the derived exponent.

full rationale

The central derivation, Eqs. (10)-(16), starts from the rest-frame thermal expectation values ⟨a_k a†_{k'} + a†_k a_{k'}⟩ = δ*(k-k') coth((βω_k - α)/2), attributed to the independent work of Ford and O'Connell [14], and transforms them under ρ' = U(Λ)ρU(Λ)† using only the cyclic trace property and the Lorentz invariance of the measure. No parameter is fitted and no target result is inserted. The four-vector temperature is not assumed in deriving the spectrum; it is defined at Eq. (18) as β^μ = βu^μ after the spectrum is obtained, and Eq. (20) then merely rewrites the argument βγ(ω' + k̂'·v√(ω'^2-m^2)) as β'_μP'^μ. The no-scalar-temperature conclusion for massive fields follows from the derived expression for the ratio ω'/β'_μP'^μ containing ω' (Sec. III.A), which is a mathematical consequence rather than an input. The massless bosonic limit is checked against Ford-O'Connell [14], an external benchmark. Although the result is conditional on the convention that a moving observer describes the system by the unitarily transformed global Gibbs state (Eq. (10)), a change of convention would change the physical scenario, not make the derivation circular. The only author-overlap citation ([13], Quan et al.) appears in a list with independent references and is not load-bearing. Hence no circular step is exhibited.

Assumptions & free parameters 0 free parameters · 6 assumptions · 0 invented entities

The central claim rests on the choice of the globally thermal Gibbs state in the rest frame and its unitary Lorentz transform. All other ingredients are standard free-field machinery. No parameters are fitted; m, β, α, and v are inputs.

assumptions (6)
  • standard math The free real scalar field Hamiltonian H = ∫Dk ω_k/2 (a_k a†_k + a†_k a_k) with on-shell ω_k = √(k²+m²).
    Standard free-field quantum field theory, used in Sec. II.A.
  • domain assumption The equilibrium state is the grand canonical ensemble ρ_i = e^{-βH + αN}/Z in the rest frame.
    Statistical mechanics postulate; the choice of the thermal state is the load-bearing assumption for the conclusion about moving-frame spectra (Sec. II.B).
  • domain assumption Under a Lorentz transformation, the density operator transforms unitarily as ρ' = U(Λ)ρU(Λ)†.
    Assumes the standard operator-algebraic implementation of Lorentz symmetry on the Hilbert space; used in Eq. (10).
  • standard math The invariant measure Dk = d³k/((2π)³2ω_k) and the invariant delta distribution δ*(k-k') = (2π)³2ω_k δ³(k-k') are used.
    Standard relativistic normalization in Sec. II.A.
  • standard math For fermions, the anticommutation relation {b_{ks}, b†_{k's'}} = (2π)³2ω_k δ³(k-k')δ_{ss'} and thermal expectation value ⟨b b† + b† b⟩ = -δ* tanh((βω-α)/2).
    Fermionic thermal expectation values, Appendix A.
  • domain assumption The four-vector temperature is defined as βμ = βuμ, following van Kampen.
    Definition adopted from the literature (Ref. 7); the paper uses it to characterize the spectrum but does not derive it from more basic principles.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Lorentz Transformation of the Energy Spectrum of the Equilibrium State of Massive Free Fields." pith.science (2026). https://pith.science/paper/WJ2LF5TH

@misc{pith2026241220817,
  author       = {Pith},
  title        = {Pith review of: Lorentz Transformation of the Energy Spectrum of the Equilibrium State of Massive Free Fields},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/WJ2LF5TH}},
  note         = {Machine review of arXiv:2412.20817}
}
read the original abstract

In previous studies of relativistic thermodynamics, the temperature of a static system, as perceived by a moving observer, has traditionally been treated as a scalar. This assumption has also been extended to the research on the cosmic microwave background. However, the validity of this assumption is a consequence of the massless nature of photons. More generally, when an observer is in relative motion to a system, the thermal equilibrium state is characterized by a four-vector temperature. In this paper, we study the non-interacting massive Bosonic and Fermionic field systems. We derive the Lorentz transformation of the energy spectral density in the equilibrium state of these fields. In the massless limit for bosonic field, our results recover the transformation of black body radiation [G. W. Ford and R. F. O' Connell., Phys. Rev. E, 88, 044101(2013)], which corresponds to a scalar temperature with dipole anisotropy. For the massive fields, the moving equilibrium state cannot be characterized by a corresponding scalar temperature. This result shows the necessity of introducing four-vector temperature in relativistic thermodynamics.

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

21 extracted references · 21 canonical work pages

  1. [1]

    Dunkel, P

    J. Dunkel, P. H¨ anggi, and S. Hilbert, Non-local observ- ables and lightcone-averaging in relativistic thermody- namics, Nature Physics 5, 741 (2009)

    work page 2009

  2. [2]

    Far ´ ıas, V

    C. Far ´ ıas, V. A. Pinto, and P. S. Moya, What is the tem- perature of a moving body?, Scientific Reports 7 (2017)

    work page 2017

  3. [3]

    Plank, Zur dynamik bewegter systeme, Ann

    M. Plank, Zur dynamik bewegter systeme, Ann. Phys. 331 (1908)

    work page 1908

  4. [4]

    Einstein, ¨Uber das relativit¨ atsprinzip und die aus demselben gezogenen folgerungen, Jahrb

    A. Einstein, ¨Uber das relativit¨ atsprinzip und die aus demselben gezogenen folgerungen, Jahrb. Radioakt. Elektron 4 (1907)

    work page 1907

  5. [5]

    Ott, Lorentz-transformation der wrme und der tem- peratur, Z

    H. Ott, Lorentz-transformation der wrme und der tem- peratur, Z. Physik 175 (1963)

    work page 1963

  6. [6]

    P. T. Landsberg, Does a moving body appear cool?, Na- ture 212 (1966)

    work page 1966

  7. [7]

    van Kampen, Relativistic thermodynamics of moving systems, Phys. Rev. 173 (1968)

    work page 1968

  8. [8]

    A. A. Penzias and R. W. Wilson, A Measure- ment of Excess Antenna Temperature at 4080 Mc/s., Astrophys. J (Letters) 142, 419 (1965)

    work page 1965

Show all 21 references
  1. [9]

    E. K. Conklin, Velocity of the earth with respect to the cosmic background radiation, Nature 88, 971 (1969)

    1969

  2. [10]

    G. F. Smoot, M. V. Gorenstein, and R. A. Muller, De- tection of anisotropy in the cosmic blackbody radiation, Phys. Rev. Lett. 39, 898 (1977)

    1977

  3. [11]

    T. K. Nakamura, Lorentz transform of black-body radia- tion temperature, Europhysics Letters 88, 20004 (2009)

    2009

  4. [12]

    Derakhshani, Black body radiation in moving frames, HAL (2019)

    K. Derakhshani, Black body radiation in moving frames, HAL (2019)

    2019

  5. [13]

    Pei, J.-F

    J.-H. Pei, J.-F. Chen, and H. T. Quan, Special rel- ativistic covariant fluctuation theorems (2023), arXiv: 8 2312.17621

    2023 arXiv

  6. [14]

    G. W. Ford and R. F. O’Connell, Lorentz transformation of blackbody radiation, Phys. Rev. E 88 (2013)

    2013

  7. [15]

    C. V. Heer and R. H. Kohl, Theory for the measurement of the earth’s velocity through the 3 °k cosmic radiation, Phys. Rev. 174, 1611 (1968)

    1968

  8. [16]

    R. N. Bracewell and E. K. Conklin, An observer moving in the 3 ° k radiation field, Nature 219, 1343 (1968)

    1968

  9. [17]

    G. R. Henry, R. B. Feduniak, J. E. Silver, and M. A. Peterson, Distribution of blackbody cavity radiation in a moving frame of reference, Phys. Rev. 176, 1451 (1968)

    1968

  10. [18]

    P. J. E. Peebles and D. T. Wilkinson, Com- ment on the anisotropy of the primeval fireball, Phys. Rev. 174, 2168 (1968)

    1968

  11. [19]

    Scott, The cosmic neutrino background (2024), arXiv : 2402.16243

    D. Scott, The cosmic neutrino background (2024), arXiv : 2402.16243

    2024 arXiv

  12. [20]

    Pathria and P

    R. Pathria and P. D. Beale, Statistical mechanics (four th edition) (Academic Press, 2022) p. 303

    2022

  13. [21]

    Https://lambda.gsfc.nasa.gov/product/cobe/

Pith tools

Reviewed August 10, 2026 · model on record in the stance chip above.