Pith. sign in

REVIEW 4 major objections 5 minor 1 cited by

Self-seeded photon acceleration by electron beam-driven transition radiation

T0 review · 4 major / 5 minor · reviewed 2026-08-07 · deepseek-v4-flash

Pith's one-line read Simulations show an electron beam can seed its own photon acceleration—transition radiation from the vacuum–plasma boundary—and upshift it from 4.4 µm to 184 nm in 1.6 mm.

desk verdict Genuinely novel self-seeded photon acceleration simulation, but the 184 nm output needs a causality check before the central claim fully lands. read the letter →

arxiv 2506.06531 v1 pith:4JAY7OS7 submitted 2025-06-06 physics.plasm-ph physics.acc-phphysics.optics

classification physics.plasm-phphysics.acc-phphysics.optics
keywords photonaccelerationtransitionradiationplasmawakefieldself-seededfrequencyupshiftradiallypolarizedultravioletcoherentparticle-in-cellsimulation
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper proposes and simulates a scheme in which an electron beam, entering a plasma, generates its own seed photons—transition radiation from the vacuum–plasma interface—and then accelerates those photons in the plasma wake it drives, eliminating the need for an external laser and its synchronization. The central demonstration is a simulated 1 GeV, 5 nC electron bunch that frequency-upshifts its transition radiation from 4.4 µm (mid-infrared) to 184 nm (ultraviolet) over 1.6 mm of a two-plateau plasma, a more than twenty-fold frequency boost. The authors also show that the output wavelength can be tuned by adjusting plasma length and density, with an estimated lower bound near 50 nm set by the inter-electron spacing at plasma densities around $10^{19}$ $cm^{-3}$. If correct, this self-seeded photon acceleration offers a practical route to high-power, radially polarized, wavelength-tunable ultraviolet pulses without laser–accelerator synchronization.

What carries the argument

The central mechanism is photon acceleration in a plasma wake, quantified by the fractional frequency shift $\Delta\omega/\omega_0 \approx -(\omega_p^2/2\omega_0^2)(c/n_0)\int (\partial n/\partial \zeta)\,dt$, where $n$ is the perturbed electron density and $\zeta = z - ct$ is the co-moving coordinate. The seed is coherent transition radiation generated when the pancake electron bunch crosses the vacuum–plasma interface: the beam's radial self-field pushes plasma electrons into a thin layer, and the layer's acceleration and turning emit forward-propagating radiation that the wake then captures. The paper confirms this seed picture by computing the classical retarded-potential radiation from test-electron trajectories and matching the PIC radiation field. A second piece of machinery is the two-stage density profile, which rephases the pulse onto a fresh wake to continue the upshift.

What would settle it

A full three-dimensional particle-in-cell simulation with no azimuthal symmetry restriction, or a beam-facility experiment, that measures the forward spectrum after 1.6 mm of the two-plateau plasma; if the main pulse does not emerge near 184 nm with a radially polarized profile, or if the energy transfer is far below 0.15%, the self-seeded photon acceleration claim is not supported.

Watch

Extended reading notes

Core claim

The discovery is that coherent transition radiation produced when an ultra-relativistic pancake electron bunch crosses a vacuum–plasma interface can serve as a naturally synchronized seed for photon acceleration in the wakefield the same bunch drives. In quasi-three-dimensional particle-in-cell simulations, the radially polarized seed at 4.4 µm is first upshifted in a quasi-one-dimensional wake, then held or further boosted in the blowout regime, and finally rephased into a steep bubble-edge density gradient, reaching 184 nm. The paper identifies three stages—quasi-1D wake, blowout, and rephasing—and shows that a two-plateau density profile improves energy transfer efficiency to 0.15%, compared with 0.057% for a uniform plasma. The generated pulse remains radially polarized and carries 1.69 mJ at 184 nm, with a normalized field amplitude near 0.07. This is presented as a proof-of-concept for beam-driven photon acceleration from infrared to ultraviolet without an external seed.

Load-bearing premise

The entire wavelength evolution is extracted from a simulation that assumes near-cylindrical symmetry and keeps only two azimuthal modes, so the result rests on the electron beam remaining axisymmetric; if beam hose or other transverse instabilities develop, the reported 184 nm upshift could change.

Editorial extensions

If this is right

  • No external seed laser is needed, so the scheme removes synchronization and alignment constraints that limit current laser-seeded photon acceleration designs.
  • The output wavelength is tunable: short plasma lengths yield long-wavelength infrared radially polarized vector pulses, while tailored density profiles push the pulse into the ultraviolet.
  • A two-stage density ladder improves the energy conversion efficiency from 0.057% (uniform plasma) to 0.15% (1.69 mJ, 184 nm), and even a realistic 100 µm density ramp still gives 0.116%.
  • The minimum attainable wavelength is set by the inter-electron spacing, roughly 50 nm at 10^19 cm^-3, so with optimized plasma engineering sub-100 nm radially polarized ultraviolet pulses become plausible.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Going beyond the paper, the same self-seeding logic should apply to other beam–plasma interfaces with sharp or shaped density fronts, so the scheme might be tested at existing electron-beam facilities with modest changes.
  • The three-stage picture predicts a specific chirp signature—positive chirp in the first stage and reversal in the third—that could be used experimentally as a non-invasive diagnostic of the wake structure, since the pulse chirp tracks the density gradient it traverses.
  • If the efficiency can be raised by further profile optimization, beam-driven photon acceleration could become a competitive source of femtosecond ultraviolet pulses, but this depends on suppressing the azimuthal instabilities excluded by the two-mode cylindrical symmetry truncation.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 5 minor

Summary. The manuscript proposes a self-seeded photon acceleration scheme in which transition radiation (TR) generated when a 1 GeV electron bunch crosses a vacuum-plasma interface acts as the seed for frequency upshift in a beam-driven plasma wake, eliminating the need for an external laser. Using quasi-3D FBPIC simulations, the authors report wavelength reduction from 4.4 μm to 201 nm in a uniform plasma and to 184 nm in a two-stage tailored plasma over roughly 1.6 mm, with conversion efficiencies of 0.057% and 0.15% respectively. A Liénard-Wiechert calculation with test electrons is used to support the initial TR generation mechanism.

Significance. If the central claim holds, the scheme offers a practical way to generate radially polarized UV radiation from electron beams without external laser synchronization, with parameters in reach of facilities such as FACET-II. The paper has clear strengths: it uses a state-of-the-art spectral PIC code (FBPIC), provides an independent Liénard-Wiechert cross-check of the seed radiation mechanism, and discusses a concrete two-stage density-ladder design for efficiency improvement. However, the quantitative central claim depends on an incompletely specified spectral filter and on the unproven identity of the output pulse as the upshifted TR seed, so the significance is currently conditional on those points being resolved.

major comments (4)
  1. [Section 4.1, Figure 2] The wavelength evolution is extracted from the E_r field, and the text states only that 'The electrostatic component of the wakefield is eliminated after filtering,' without defining the filter. The filter type, cutoff, spatial or spectral window, and any mode selection must be specified, and raw versus filtered spectra should be shown, because the reported 201 nm and 184 nm wavelengths are the basis of the abstract's central claim.
  2. [Sections 4.2 and 5] The Liénard-Wiechert calculation in Section 4.2 validates the initial generation of TR at t = 166.8 fs, but it does not establish that the 184 nm pulse at the plasma exit is the same wave packet as the 4.4 μm TR seed. Newly generated radiation from the beam-plasma system, such as nonlinear wake emission or exit-boundary transition radiation, could contaminate the extracted spectrum. A control simulation without the vacuum-plasma interface, or a wave-packet-tracking/causality analysis, is needed to support the 'self-seeded' claim.
  3. [Section 3] The simulation fidelity is not demonstrated: the statement that two azimuthal modes (N_m=2) suffice is asserted without a convergence study, and there are no resolution, box-size, or macroparticle-number scans. Since the central result is entirely simulation-based and the regime n_b/n_p = 1 with 4.5 mm propagation could be susceptible to beam hose or filamentation, the authors should provide convergence tests with higher N_m and varied numerical parameters.
  4. [Sections 3 and 5; Abstract] There is an inconsistency in the plasma density specification: Section 3 describes a uniform plasma with n_p = 1.74 × 10^19 cm^-3 over a 4.5 mm plateau, while Section 5 uses a two-stage profile with '0.01 n_c' and a second plateau at three times that density, and the abstract refers to 'two-stage uniform plasma.' The densities must be given in consistent units and the geometry of the configuration that produces 184 nm versus 201 nm must be clearly stated, otherwise the central result is not reproducible.
minor comments (5)
  1. [Section 5] The quantity n_c in '0.01 n_c' is not defined; it should be stated whether this is the critical density for a particular wavelength or another reference density, and the corresponding numerical value in cm^-3 should be given.
  2. [References] Reference 18 appears incomplete: it lists authors and a year but no journal, volume, or DOI; please provide full bibliographic information.
  3. [Figure 3 caption] The caption refers to 'wavelength spectra of E_r within the shaded yellow regions in panels (d-f),' but it may help to explicitly indicate the shaded regions in the figure panels, as they are not obvious from the text.
  4. [Section 4.2] In Equation (2), the notation for the beam density profile is introduced with n_b = n_0 exp(...), but n_0 is then used for both the background plasma density and the beam peak density; using distinct symbols for these two densities would avoid confusion.
  5. [Abstract] The phrase 'two-stage uniform plasma' is ambiguous and appears to contradict the tailored density-ladder description in Section 5; consider rephrasing to 'two-stage plasma with a density step' or similar.

Circularity Check

0 steps flagged · score 1.0 of 10

No circular reduction: the 184 nm frequency upshift is a PIC simulation output; Eq. (1) is an interpretive no-parameter formula, the Liénard–Wiechert check is corroborative, and there are no fitted constants or self-citation chains.

full rationale

The paper's central claim, that TR seeded at 4.4 μm is accelerated to 184 nm in a beam-driven plasma wake, is produced by a first-principles quasi-3D PIC simulation (FBPIC), not by fitting or by Eq. (1). Equation (1), taken from the external photon-accelerator literature (Ref. 10), contains no free parameters and is used only to interpret why the quasi-1D stage provides a large accelerating gradient (Δω/ω0 ∝ 1/ω0^2); the reported wavelengths are obtained by Fourier-transforming the simulated E_r field, so the upshift is an emergent output, not a fitted constant renamed as a prediction. The Section 4.2 Liénard–Wiechert computation (Eqs. 3–4, PyCharge) is an independent radiation-theory calculation that corroborates the seed-generation mechanism at t = 166.8 fs; it validates the input stage but does not generate the 184 nm outcome. No parameter is fitted to reproduce the final wavelength, and the plasma density, beam parameters, and ramp profiles are adopted from the FACET-II literature (Refs. 19–20). The reference list contains no self-citations, so no self-citation chain, imported-uniqueness theorem, or ansatz-via-citation is load-bearing. The principal caveats raised by a skeptical reading—an unspecified spectral filter that 'eliminates the electrostatic component of the wakefield,' and the absence of a photon-tagging or causality check proving the 184 nm pulse is the descendant of the 4.4 μm TR rather than newly generated beam/plasma radiation—are diagnostic-robustness and wave-packet-identity concerns, not a reduction of the result to its inputs by construction. Under the hard rules, circularity cannot be claimed for these points because the paper exhibits no step where an output quantity equals an input quantity by definition, and no fitted parameter is renamed as a prediction. The honest finding is therefore no significant circularity; the score of 1 reflects only the mild opacity of the spectral-filter diagnostic, not a circular step.

Assumptions & free parameters 3 free parameters · 4 assumptions · 0 invented entities

The simulation results rest on standard electrodynamics and on physical assumptions about plasma wake behavior. The beam and plasma parameters are hand-chosen design inputs, not fitted constants. The most consequential assumption is the quasi-3D cylindrical truncation with N_m=2, which is load-bearing but untested for instabilities.

free parameters (3)
  • Initial electron beam parameters = 1 GeV, 5 nC, σ_z=0.5 μm, σ_r=15 μm
    Hand-chosen to match FACET-II-class beams; the resulting frequency shift depends on these values.
  • Plasma density = n_p = 1.74e19 cm^-3
    Set equal to beam density to reach n_b/n_p=1 for relativistic transition radiation; a design choice, not derived.
  • Two-stage density ratio and lengths = 3x density jump, 0.7 mm plateaus, 0.1 mm ramps
    Chosen after observing the stage-II plateau in the uniform case; an optimization parameter that directly affects the reported 184 nm result.
assumptions (4)
  • standard math Liénard-Wiechert potentials give the radiation field of moving point charges
    Used in Section 4.2 to model transition radiation from test electrons.
  • domain assumption The photon acceleration formula Eq. (1) (from ref [10]) describes frequency upshift in plasma wakes
    Used in Section 2 to motivate the mechanism; not used in the simulation itself.
  • domain assumption Cylindrical symmetry with N_m=2 azimuthal modes is sufficient to capture the physics
    Stated in Section 3; if non-axisymmetric instabilities grow, the reported wavelength evolution could change.
  • domain assumption The electrostatic component of the wake can be cleanly separated from the radiation by frequency filtering
    Used in Section 4.1 to define the light pulse spectrum; the filter's effect is not quantified.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Self-seeded photon acceleration by electron beam-driven transition radiation." pith.science (2026). https://pith.science/paper/4JAY7OS7

@misc{pith2026250606531,
  author       = {Pith},
  title        = {Pith review of: Self-seeded photon acceleration by electron beam-driven transition radiation},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/4JAY7OS7}},
  note         = {Machine review of arXiv:2506.06531}
}
read the original abstract

Photon acceleration (PA) driven by ultra-relativistic electron beams offers a promising approach to generating high-power, high-frequency coherent radiation sources. While current methods typically rely on external optical laser pulses injected into beam-driven plasma wakefields, they face significant challenges in synchronization and alignment between electron accelerators and laser systems. We propose utilizing transition radiation (TR) generated by the drive electron bunch transversing the vacuum-gas interface as the seed photons of PA. Using a 1 GeV electron bunch, we demonstrate acceleration of TR from 4.4 {\mu}m to 184 nm in 1.6 mm of two-stage uniform plasma, achieving more than a 20-fold frequency boost. Further frequency increases can be achieved with optimized setups. This scheme addresses the synchronization and alignment issues present in previous approaches, providing a practical path toward beam-driven photon acceleration.

Figures

Figures reproduced from arXiv: 2506.06531 by the authors.

Figure 1
Figure 1. Schematic diagram of the beam–plasma interaction configuration. (a) Ultraviolet pulse generation occurs when an ultra-short electron beam, with a density equal to the plasma density 𝑛𝑏 = 𝑛𝑝, impinges on a uniform plasma with up- and down-ramp of 0.1 mm. (b-d) The evolution of electron beam density (green), plasma electron density (gray), and radial electric field in 𝜃 = 0 plane at propagation distances of 0.1 mm, 1 … view at source ↗
Figure 3
Figure 3. Extracted radial electric field and plasma density distributions at 𝑟 = 3𝜇𝑚 for electron beam positions indicated in Figures 1(b-d). (a-c) The time￾frequency analysis of 𝐸𝑟 obtained via short-time Fourier transforms. (d-f) The evolution of radial electric field (red line) and plasma density (gray line) profiles at corresponding positions. (g) The wavelength spectra of 𝐸𝑟 within the shaded yellow regions in panels (d… view at source ↗
Figure 4
Figure 4. Spatiotemporal evolution of electron density and radial electric field. (a-c) The electron beam density (green), plasma electron density (gray), and radial electric field distributions at 50.0 fs, 83.4 fs, and 166.8 fs, respectively. For concrete explanation of the effect, the radiation field of the electron in the electron layer is shown in in [PITH_FULL_IMAGE:figures/full_fig_p007_4.png] view at source ↗
Figures from the paper (1 more)
Figure 6
Figure 6. Figure 6: Photon acceleration in a tailored plasma. (a) The longitudinal plasma [PITH_FULL_IMAGE:figures/full_fig_p009_6.png]

Discussion (0). Sign in to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Strong Energy Dependent Transition Radiation in a Photonic Crystal

    physics.acc-ph 2025-11 conditional novelty 7.0 of 10

    A 1D photonic crystal designed with a specific thickness ratio produces transition radiation at Brewster's angle whose intensity scales as γ⁴ for relativistic particles before N_s² saturation.

Reference graph

Works this paper leans on

37 extracted references · 37 canonical work pages · cited by 1 Pith paper

  1. [1]

    In this process, photons gain energy from plasma waves whi le the pulse undergoes temporal compression [3], potentially enabling significant power enhancement

    Introduction Photon acceleration (PA), which exploits frequency up-shift of light co-propagating with a decreasing refractive index, offers a promising approach for generating high -power, short - wavelength radiation [1,2]. In this process, photons gain energy from plasma waves whi le the pulse undergoes temporal compression [3], potentially enabling sig...

  2. [2]

    photon generator

    Self-seeded Photon Accelerating Scheme The interaction scheme of SPA is illustrated in Figure 1(a), using a 1 GeV electron beam with a 5 nC beam charge. The driven beam takes a pancake shape, characterized by a transverse size significantly larger than its longitudinal size ( σ𝑧 = 0.5μm, σ𝑟 = 15μm). S uch electron sources are achievable at the forthcoming...

  3. [3]

    It solves Maxwell's equations using a spectral approach in cylindrical coordinates, mitigating spurious numerical dispersion

    Simulation Setup To model the SPA scheme, we perform spectral, quasi-three-dimensional PIC simulations using the Fourier -Bessel Particle -In-Cell code (FBPIC) [26]. It solves Maxwell's equations using a spectral approach in cylindrical coordinates, mitigating spurious numerical dispersion. It decomposes the electromagnetic field into a set of 2D radial g...

  4. [4]

    The electrostatic component of the wakefield is eliminated after filtering

    Results 4.1 Acceleration of transition radiation The evolution of the radiation spectrum is shown in Figure 2(a), calculated by Fouri er transform of the 𝐸𝑟 field along the z -direction and summed over radius. The electrostatic component of the wakefield is eliminated after filtering. The wavelength decreases rapidly from 4.4 μ𝑚 to 267 nm, stabilizes, and...

  5. [5]

    In the blowout regime, the pulse resides insid e the bubble, thereby inhibiting an increase in pulse frequency

    Discussion The second stage of the uniform plasma case leads to reduced energy transfer efficiency. In the blowout regime, the pulse resides insid e the bubble, thereby inhibiting an increase in pulse frequency. Consequently, both the pulse and the electron beam lose nearly half of their initial energy during the second stage. To improve energy transfer e...

  6. [6]

    We found that the forward CTR generated at the front vacuum - plasma interface can be guided within the plasma wake, and the radiation frequency is modulated from IR to UV

    Conclusion In summary, we present a proof -of-concept demonstration of the interaction between an ultra-short relativistic electron beam and a tenuous plasma with a density ratio of approximately 𝑛𝑏/𝑛𝑝 = 1 using FBPIC. We found that the forward CTR generated at the front vacuum - plasma interface can be guided within the plasma wake, and the radiation fre...

  7. [7]

    Photon accelerator,

    S. C. Wilks, J. M. Dawson, W. B. Mori, et al., "Photon accelerator," Phys. Rev. Lett. 62, 2600–2603 (1989)

  8. [8]

    Interaction of electromagnetic waves with a moving ionization front,

    M. Lampe, E. Ott, and J. H. Walker, "Interaction of electromagnetic waves with a moving ionization front," The Physics of Fluids 21, 42–54 (1978)

Show all 37 references
  1. [9]

    Complete Temporal Characterization of Asymmetric Pulse Compression in a Laser Wakefield,

    J. Schreiber, C. Bellei, S. P. D. Mangles, et al., "Complete Temporal Characterization of Asymmetric Pulse Compression in a Laser Wakefield," Phys. Rev. Lett. 105, 235003 (2010)

  2. [10]

    Experimental Evidence of Photon Acceleration of Ultrashort Laser Pulses in Relativistic Ionization Fronts,

    J. M. Dias, C. Stenz, N. Lopes, et al., "Experimental Evidence of Photon Acceleration of Ultrashort Laser Pulses in Relativistic Ionization Fronts," Phys. Rev. Lett. 78, 4773–4776 (1997)

  3. [11]

    Photon acceleration versus frequency-domain interferometry for laser wakefield diagnostics,

    J. M. Dias, L. Oliveira E Silva, and J. T. Mendonç a, "Photon acceleration versus frequency-domain interferometry for laser wakefield diagnostics," Phys. Rev. ST Accel. Beams 1, 031301 (1998)

  4. [12]

    Photon acceleration of ultrashort laser pulses by relativistic ionization fronts,

    J. M. Dias, N. C. Lopes, L. O. Silva, et al., "Photon acceleration of ultrashort laser pulses by relativistic ionization fronts," Phys. Rev. E 66, 056406 (2002)

  5. [13]

    Laser pulse frequency up-shifts by relativistic ionization fronts,

    N. C. Lopes, G. Figueira, J. M. Dias, et al., "Laser pulse frequency up-shifts by relativistic ionization fronts," Europhys. Lett. 66, 371–377 (2004)

  6. [14]

    Evidence of photon acceleration by laser wake fields,

    C. D. Murphy, R. Trines, J. Vieira, et al., "Evidence of photon acceleration by laser wake fields," Physics of Plasmas 13, 033108 (2006)

  7. [15]

    Photon acceleration and modulational instability during wakefield excitation using long laser pulses,

    R. M. G. M. Trines, C. D. Murphy, K. L. Lancaster, et al., "Photon acceleration and modulational instability during wakefield excitation using long laser pulses," Plasma Phys. Control. Fusion 51, 024008 (2009)

  8. [16]

    Simulation of density measurements in plasma wakefields using photon acceleration,

    M. F. Kasim, N. Ratan, L. Ceurvorst, et al., "Simulation of density measurements in plasma wakefields using photon acceleration," Phys. Rev. ST Accel. Beams 18, 032801 (2015)

  9. [17]

    Quantitative single shot and spatially resolved plasma wakefield diagnostics,

    M. F. Kasim, J. Holloway, L. Ceurvorst, et al., "Quantitative single shot and spatially resolved plasma wakefield diagnostics," Phys. Rev. ST Accel. Beams 18, 081302 (2015)

  10. [18]

    Photon Acceleration in a Flying Focus,

    A. J. Howard, D. Turnbull, A. S. Davies, et al., "Photon Acceleration in a Flying Focus," Phys. Rev. Lett. 123, 124801 (2019)

  11. [19]

    Optical shock-enhanced self-photon acceleration,

    P. Franke, D. Ramsey, T. T. Simpson, et al., "Optical shock-enhanced self-photon acceleration," Phys. Rev. A 104, 043520 (2021)

  12. [20]

    Photon Acceleration from Optical to XUV,

    R. T. Sandberg and A. G. R. Thomas, "Photon Acceleration from Optical to XUV," Phys. Rev. Lett. 130, 085001 (2023)

  13. [21]

    Electron-beam-driven plasma wakefield acceleration of photons,

    R. T. Sandberg and A. G. R. Thomas, "Electron-beam-driven plasma wakefield acceleration of photons," Physics of Plasmas 30, 113105 (2023)

  14. [22]

    Dephasingless plasma wakefield photon acceleration,

    R. Sandberg and A. G. R. Thomas, "Dephasingless plasma wakefield photon acceleration," Phys. Rev. E 109, 025210 (2024)

  15. [23]

    Photon acceleration of high-intensity vector vortex beams into the extreme ultraviolet,

    K. G. Miller, J. R. Pierce, F. Li, et al., "Photon acceleration of high-intensity vector vortex beams into the extreme ultraviolet," Commun Phys 8, 229 (2025)

  16. [24]

    Reaching extreme fields in laser-electron beam collisions with XUV laser light,

    B. K. Russell, C. P. Ridgers, S. S. Bulanov, et al., "Reaching extreme fields in laser-electron beam collisions with XUV laser light," (2025)

  17. [25]

    FACET-II facility for advanced accelerator experimental tests,

    V. Yakimenko, L. Alsberg, E. Bong, et al., "FACET-II facility for advanced accelerator experimental tests," Phys. Rev. Accel. Beams 22, 101301 (2019)

  18. [26]

    Experimental Generation of Extreme Electron Beams for Advanced Accelerator Applications,

    C. Emma, N. Majernik, K. K. Swanson, et al., "Experimental Generation of Extreme Electron Beams for Advanced Accelerator Applications," Phys. Rev. Lett. 134, 085001 (2025)

  19. [27]

    Extremely Dense Gamma-Ray Pulses in Electron Beam-Multifoil Collisions,

    A. Sampath, X. Davoine, S. Corde, et al., "Extremely Dense Gamma-Ray Pulses in Electron Beam-Multifoil Collisions," Phys. Rev. Lett. 126, 064801 (2021)

  20. [28]

    Generation of Terawatt Attosecond Pulses from Relativistic Transition Radiation,

    X. Xu, D. B. Cesar, S. Corde, et al., "Generation of Terawatt Attosecond Pulses from Relativistic Transition Radiation," Phys. Rev. Lett. 126, 094801 (2021)

  21. [29]

    Beam optics of a self-focusing plasma lens,

    J. B. Rosenzweig and P. Chen, "Beam optics of a self-focusing plasma lens," Phys. Rev. D 39, 2039–2045 (1989)

  22. [30]

    Plasma lenses for focusing particle beams,

    J. J. Su, T. Katsouleas, J. M. Dawson, et al., "Plasma lenses for focusing particle beams," Phys. Rev. A 41, 3321–3331 (1990)

  23. [31]

    Energy loss of a high-charge bunched electron beam in plasma: Analysis,

    N. Barov, J. B. Rosenzweig, M. C. Thompson, et al., "Energy loss of a high-charge bunched electron beam in plasma: Analysis," Phys. Rev. ST Accel. Beams 7, 061301 (2004)

  24. [32]

    A spectral, quasi-cylindrical and dispersion-free Particle-In-Cell algorithm,

    R. Lehe, M. Kirchen, I. A. Andriyash, et al., "A spectral, quasi-cylindrical and dispersion-free Particle-In-Cell algorithm," Computer Physics Communications 203, 66–82 (2016)

  25. [33]

    J. D. Jackson, Classical Electrodynamics, 3. ed., [Nachdr.] (Wiley, 2009)

  26. [34]

    PyCharge: An open-source Python package for self-consistent electrodynamics simulations of Lorentz oscillators and moving point charges,

    M. J. Filipovich and S. Hughes, "PyCharge: An open-source Python package for self-consistent electrodynamics simulations of Lorentz oscillators and moving point charges," Computer Physics Communications 274, 108291 (2022)

  27. [35]

    Sharper Focus for a Radially Polarized Light Beam,

    R. Dorn, S. Quabis, and G. Leuchs, "Sharper Focus for a Radially Polarized Light Beam," Phys. Rev. Lett. 91, 233901 (2003)

  28. [36]

    Intense high-order harmonic vector beams from relativistic plasma mirrors,

    Z.-Y. Chen and R. Hu, "Intense high-order harmonic vector beams from relativistic plasma mirrors," Phys. Rev. A 103, 023507 (2021)

  29. [37]

    The photon accelerator: A novel method of frequency upshifting sub-picosecond laser pulses,

    S. C. Wilks, T. Katsouleas, and J. M. Dawson, "The photon accelerator: A novel method of frequency upshifting sub-picosecond laser pulses," in AIP Conference Proceedings (AIP, 1989), Vol. 193, pp. 448–470

Pith tools

Reviewed August 7, 2026 · model on record in the stance chip above.